SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP55718_P050
Price: $0.00
SKU
ARP55718_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

SFRS12IP1 Antibody - N-terminal region (ARP55718_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
Datasheets/ManualsPrintable datasheet for anti-SREK1IP1 (ARP55718_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Yeast, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human SFRS12IP1
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 93%; Dog: 93%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rat: 100%; Yeast: 77%; Zebrafish: 86%
Peptide SequenceSynthetic peptide located within the following region: GYPGHLTFECRNFLRVDPKRDIVLDVSSTSSEDSDEENEELNKLQALQEK
Concentration0.5 mg/ml
Blocking PeptideFor anti-SREK1IP1 (ARP55718_P050) antibody is Catalog # AAP55718 (Previous Catalog # AAPP36418)
Gene SymbolSREK1IP1
Gene Full NameSREK1-interacting protein 1
Alias SymbolsP18SRP, SFRS12IP1
NCBI Gene Id285672
Protein NameProtein SREK1IP1
Description of TargetSFRS12IP1 is a possible splicing regulator involved in the control of cellular survival.
Uniprot IDQ8N9Q2
Protein Accession #NP_776190
Nucleotide Accession #NM_173829
Protein Size (# AA)155
Molecular Weight18kDa
Protein InteractionsRP9P; STAC3; PPCDC; HSD17B14; SDCBP2; RBM39; SDCBP; NME1;
  1. What is the species homology for "SFRS12IP1 Antibody - N-terminal region (ARP55718_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Yeast, Zebrafish".

  2. How long will it take to receive "SFRS12IP1 Antibody - N-terminal region (ARP55718_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "SFRS12IP1 Antibody - N-terminal region (ARP55718_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "SFRS12IP1 Antibody - N-terminal region (ARP55718_P050)"?

    This target may also be called "P18SRP, SFRS12IP1" in publications.

  5. What is the shipping cost for "SFRS12IP1 Antibody - N-terminal region (ARP55718_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "SFRS12IP1 Antibody - N-terminal region (ARP55718_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "SFRS12IP1 Antibody - N-terminal region (ARP55718_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "18kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "SFRS12IP1 Antibody - N-terminal region (ARP55718_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "SREK1IP1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "SREK1IP1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "SREK1IP1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "SREK1IP1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "SREK1IP1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "SREK1IP1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:SFRS12IP1 Antibody - N-terminal region (ARP55718_P050)
Your Rating