website statistics
Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
50ug
$289.00
In Stock

SFRS12 antibody - N-terminal region (ARP51872_P050)

Description of Target:
SFRS12 belongs to the superfamily of serine/arginine-rich (SR) splicing factors. It modulates splice site selection by regulating the activities of other SR proteins.SFRS12 belongs to the superfamily of serine/arginine-rich (SR) splicing factors. It modulates splice site selection by regulating the activities of other SR proteins (Barnard et al., 2002 [PubMed 11991645]).[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-78 AW963850.1 1-78 79-415 AK091758.1 1-337 416-2238 BC067770.1 609-2431 2239-3654 BC112343.1 1800-3215 3655-3660 AK125893.1 3379-3384 3661-4030 AL049309.1 705-1074
Gene Symbol:
SREK1
Official Gene Full Name:
Splicing regulatory glutamine/lysine-rich protein 1
NCBI Gene Id:
140890
Alias Symbols:
DKFZp564B176; MGC133045; SRrp508; SRrp86; SFRS12
Sample Type Confirmation:

SREK1 is supported by BioGPS gene expression data to be expressed in HT1080

Tissue Tool:
Find tissues and cell lines supported to express SFRS12.
Protein Accession #:
NP_001070667
Nucleotide Accession#:
NM_001077199
Swissprot Id:
Q8WXA9-2
Host:
Rabbit
Clonality:
Polyclonal
Protein Name:
Splicing regulatory glutamine/lysine-rich protein 1
Protein Size (# AA):
624
Molecular Weight:
72kDa
Application:
WB
Immunogen:
The immunogen for anti-SFRS12 antibody: synthetic peptide directed towards the N terminal of human SFRS12
Product Format:
Lyophilized powder
Purification:
Affinity Purified
Complete computational species homology data:
SFRS12 antibody - N-terminal region (ARP51872_P050)
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Rabbit: 100%; Guinea pig: 100%; Mouse: 92%; Zebrafish: 92%
Species Reactivity:
Human, Rabbit, Rat, Guinea pig, Dog, Zebrafish, Mouse
Datasheets / Downloads:
Printable datasheet for
anti-SFRS12 antibody
- ARP51872_P050
Peptide Sequence:
Synthetic peptide located within the following region: DPSSVGVAQHLTNTVFIDRALIVVPCAEGKIPEESKALSLLAPAPTMTSL
Blocking Peptide:
For anti-SFRS12 antibody is Catalog # AAP51872 (Previous Catalog # AAPP40051)
Target Reference:
Ewing,R.M., Mol. Syst. Biol. 3, 89 (2007)
Reconstitution and Storage:
Add 50 ul of distilled water. Final anti-SFRS12 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.

Computational species homology for SFRS12 antibody (ARP51872)

Product page for SFRS12 antibody (ARP51872)

The information below lists the predicted species and target name associated to the peptide antigen. Please note, all available target reference numbers to the antigen sequence are presented, including unreviewed and protein isoforms.
To search for antibodies by species, please visit Aviva’s Species Reactivity Page. To search Aviva’s catalog of antibodies by sequence, please visit Aviva’s Antibody Blast Tool.

Predicted Species & Target Target Reference Predicted Homology
African elephant SREK1 antibody; Loxodonta africana SREK1 antibody G3UH54 100%
African elephant SREK1 antibody; Loxodonta africana SREK1 antibody G3TC46 100%
Chicken SREK1 antibody; Gallus gallus SREK1 antibody F1NA16 84%
Chinese hamster LOC100774662 antibody; Cricetulus griseus LOC100774662 antibody G3H4M8 92%
Duckbill platypus SREK1 antibody; Ornithorhynchus anatinus SREK1 antibody F7FYZ3 100%
Giant panda LOC100466086 antibody; Ailuropoda melanoleuca LOC100466086 antibody D2HBQ4 100%
Gray short-tailed opossum SREK1 antibody; Monodelphis domestica SREK1 antibody F7EM26 100%
Gray short-tailed opossum SREK1 antibody; Monodelphis domestica SREK1 antibody F7EM12 100%
Green anole SREK1 antibody; Anolis carolinensis SREK1 antibody G1KS97 84%
Guinea pig SREK1 antibody; Cavia porcellus SREK1 antibody H0VDG8 100%
Human SREK1 antibody; Homo sapiens SREK1 antibody Q8WXA9-2 100%
Human SREK1 antibody; Homo sapiens SREK1 antibody B3KRJ9 100%
Lowland gorilla SREK1 antibody; Gorilla gorilla gorilla SREK1 antibody G3SHT2 100%
Lowland gorilla SREK1 antibody; Gorilla gorilla gorilla SREK1 antibody G3QPY7 100%
Mouse SREK1 antibody; Mus musculus SREK1 antibody Q8BZX4-2 92%
Northern white-cheeked gibbon SREK1 antibody; Nomascus leucogenys SREK1 antibody G1QUK6 100%
Pig SREK1 antibody; Sus scrofa SREK1 antibody F1SKS1 92%
Rabbit LOC100358100 antibody; Oryctolagus cuniculus LOC100358100 antibody G1SF70 100%
Rabbit SREK1 antibody; Oryctolagus cuniculus SREK1 antibody G1U3N1 100%
Rabbit SREK1 antibody; Oryctolagus cuniculus SREK1 antibody G1TG49 100%
Rhesus macaque SREK1 antibody; Macaca mulatta SREK1 antibody F7GRE7 100%
White-tufted-ear marmoset LOC100393736 antibody; Callithrix jacchus LOC100393736 antibody F7HYA9 100%
White-tufted-ear marmoset LOC100393736 antibody; Callithrix jacchus LOC100393736 antibody F7HVZ4 100%
Zebrafish CH211-10H13.1 antibody; Danio rerio CH211-10H13.1 antibody A2BIN4 92%
Zebrafish srek1 antibody; Danio rerio srek1 antibody Q6DC65 92%

Product Protocols: SFRS12 antibody tested with Human Ht1080 Cells (ARP51872_P050)

Aviva Systems Biology is the original manufacturer of this SFRS12 antibody (ARP51872_P050)

Click here to view the SFRS12 antibody Western Blot Protocol

Product Datasheet Link: SFRS12 antibody (ARP51872_P050)

WB Suggested Anti-SFRS12 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: HT1080

Western Blot image:


Description of Target: SFRS12 belongs to the superfamily of serine/arginine-rich (SR) splicing factors. It modulates splice site selection by regulating the activities of other SR proteins.SFRS12 belongs to the superfamily of serine/arginine-rich (SR) splicing factors. It modulates splice site selection by regulating the activities of other SR proteins (Barnard et al., 2002 [PubMed 11991645]).[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-78 AW963850.1 1-78 79-415 AK091758.1 1-337 416-2238 BC067770.1 609-2431 2239-3654 BC112343.1 1800-3215 3655-3660 AK125893.1 3379-3384 3661-4030 AL049309.1 705-1074

Questions pertaining to this data can be directed to techsupport@avivasysbio.com

Aviva Systems Biology’s SFRS12 antibody (ARP51872_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com

 
X
Ask a Question