- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
SFRS1 Antibody - C-terminal region (ARP40691_P050)
Datasheets/Manuals | Printable datasheet for anti-SRSF1 (ARP40691_P050) antibody |
---|
Tested Species Reactivity | Human |
---|---|
Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Zebrafish |
Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Clonality | Polyclonal |
Host | Rabbit |
Application | WB, IHC |
Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human SFRS1 |
Purification | Affinity Purified |
Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 100% |
Peptide Sequence | Synthetic peptide located within the following region: EFVRKEDMTYAVRKLDNTKFRSHEGETAYIRVKVDGPRSPSYGRSRSRSR |
Concentration | 0.5 mg/ml |
Blocking Peptide | For anti-SRSF1 (ARP40691_P050) antibody is Catalog # AAP40691 (Previous Catalog # AAPP10434) |
Sample Type Confirmation | There is BioGPS gene expression data showing that SRSF1 is expressed in HepG2 |
Reference | Takagaki,Y., (2005) J. Biol. Chem. 280 (50), 41761-41768 |
Publications | Li, J. et al. A strategy to rapidly identify the functional targets of microRNAs by combining bioinformatics and mRNA cytoplasmic/nucleic ratios in culture cells. FEBS Lett. 584, 3198-202 (2010). 20547158 |
Gene Symbol | SRSF1 |
---|---|
Gene Full Name | Serine/arginine-rich splicing factor 1 |
Alias Symbols | ASF, SF2, SFRS1, SF2p33, SRp30a |
NCBI Gene Id | 6426 |
Protein Name | Serine/arginine-rich splicing factor 1 |
Description of Target | SFRS1 is a member of the arginine/serine-rich splicing factor protein family, and functions in both constitutive and alternative pre-mRNA splicing. The protein binds to pre-mRNA transcripts and components of the spliceosome, and can either activate or repress splicing depending on the location of the pre-mRNA binding site. The protein's ability to activate splicing is regulated by phosphorylation and interactions with other splicing factor associated proteins. Multiple transcript variants encoding different isoforms have been found for this gene.Alternative mRNA splicing plays an important role in development and differentiation; many transcripts are spliced differently in distinct cell types and tissues. Both constitutive and alternative splicing occurs on spliceosomes, which are complex particles composed of small nuclear ribonucleoproteins (snRNPs) and non-snRNP proteins. The SR family of non-snRNP splicing factors is characterized by the presence of an RNA recognition motif and a serine- and arginine-rich (SR) domain. SR proteins are required at early stages of spliceosome assembly, have distinct but overlapping specificities for different pre-mRNAs, and can alter splice site choice, suggesting that they may be involved in the regulation of alternative splicing in vivo. Two of the SR proteins, ASF/SF2 (SFRS1) and SC35 (SFRS2; MIM 600813), have been extensively characterized.Alternative mRNA splicing plays an important role in development and differentiation; many transcripts are spliced differently in distinct cell types and tissues. Both constitutive and alternative splicing occurs on spliceosomes, which are complex particles composed of small nuclear ribonucleoproteins (snRNPs) and non-snRNP proteins. The SR family of non-snRNP splicing factors is characterized by the presence of an RNA recognition motif and a serine- and arginine-rich (SR) domain. SR proteins are required at early stages of spliceosome assembly, have distinct but overlapping specificities for different pre-mRNAs, and can alter splice site choice, suggesting that they may be involved in the regulation of alternative splicing in vivo. Two of the SR proteins, ASF/SF2 (SFRS1) and SC35 (SFRS2; MIM 600813), have been extensively characterized (Bermingham et al., 1995).[supplied by OMIM]. |
Uniprot ID | Q07955 |
Protein Accession # | NP_008855 |
Nucleotide Accession # | NM_006924 |
Protein Size (# AA) | 248 |
Molecular Weight | 27kDa |
Protein Interactions | TRAF3IP2; HUWE1; SPRTN; STAU1; UBC; MDM2; ZBTB1; RNF2; EZH2; EED; SUZ12; PARK2; SRPK2; SRPK1; SRPK3; FBXO6; YWHAE; U2AF2; PAN2; MPG; CIR1; FN1; CDK6; HNRNPA0; RNPS1; SRSF10; NXF1; PRPF4; BCL10; U2AF1; SRSF4; MAGOH; SMURF1; EIF4A3; ESR1; ECT2; BRCA1; BARD1 |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "SFRS1 Antibody - C-terminal region (ARP40691_P050)"?
The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Zebrafish".
-
How long will it take to receive "SFRS1 Antibody - C-terminal region (ARP40691_P050)"?
This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".
-
What buffer format is "SFRS1 Antibody - C-terminal region (ARP40691_P050)" provided in?
This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "SFRS1 Antibody - C-terminal region (ARP40691_P050)"?
This target may also be called "ASF, SF2, SFRS1, SF2p33, SRp30a" in publications.
-
What is the shipping cost for "SFRS1 Antibody - C-terminal region (ARP40691_P050)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "SFRS1 Antibody - C-terminal region (ARP40691_P050)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "SFRS1 Antibody - C-terminal region (ARP40691_P050)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "27kDa".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "SFRS1 Antibody - C-terminal region (ARP40691_P050)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "SRSF1"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "SRSF1"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "SRSF1"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "SRSF1"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "SRSF1"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "SRSF1"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.