- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
SERPINA1 Antibody (OABB01837)
Datasheets/Manuals | Printable datasheet for SERPINA1 Antibody (OABB01837) |
---|
Tested Species Reactivity | Mouse, Rat |
---|---|
Predicted Species Reactivity | Mouse|Rat |
Product Format | Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3. |
Clonality | Polyclonal |
Clone | Polyclonal |
Isotype | Rabbit IgG |
Host | Rabbit |
Application | Immunohistochemistry|Western blot |
Additional Information | Notes: WB: The detection limit for SERPINA1 is approximately 0.1ng/lane under reducing conditions. Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. |
:: | Background: SERPINA1 is also known as PI, A1A or AAT. The protein encoded by this gene is secreted and is a serine protease inhibitor whose targets include elastase, plasmin, thrombin, trypsin, chymotrypsin, and plasminogen activator. Defects in this gene can cause emphysema or liver disease. Several transcript variants encoding the same protein have been found for this gene. |
Reconstitution and Storage | 2°C to 8°C|-20°C |
Immunogen | E.coli-derived rat SERPINA1 recombinant protein (Position: K211-R411). Rat SERPINA1 shares 66% amino acid (aa) sequence identity with human SERPINA1. |
Purification | Affinity Purified |
Peptide Sequence | Synthetic peptide located within the following region: KWKRPFNPEHTRDADFHVDKSTTVKVPMMNRLGMFDMHYCSTLSSWVLMMDYLGNATAIFLLPDDGKMQHLEQTLTKDLISRFLLNRQTRSAILYFPKLSISGTYNLKTLLSSLGITRVFNNDADLSGITEDAPLKLSQAVHKAVLTLDERGTEAAGATVVEAVPMSLPPQVKFDHPFIFMIVESETQSPLFVGKVIDPTR |
Concentration | 500 ug/ml |
Specificity | No cross reactivity with other proteins. |
Application Info | Western blot: 0.1-0.5 ug/ml: Mouse, Rat Immunohistochemistry (Paraffin-embedded Section): 0.5-1 ug/ml: Mouse, Rat: By Heat |
Reference | 1. Mixture-based combinatorial libraries from small individual peptide libraries: a case study on 1-antitrypsin deficiency.Chang YP, et al. Molecules, 2014 May 16. 2. Serpin peptidase inhibitor clade A member 1 is a biomarker of poor prognosis in gastric cancer.Kwon CH, et al. Br J Cancer, 2014 Nov 11. 3. Alpha 1-antitrypsin therapy mitigated ischemic stroke damage in rats.Moldthan HL, et al. J Stroke Cerebrovasc Dis, 2014 May-Jun. |
Storage Buffer | Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3. |
Publications | Human Urinary Epithelial Cells as a Source of Engraftable Hepatocyte-Like Cells Using Stem Cell Technology. Cell Transplant. 25, 2221-2243 (2016). 27512979 |
Description |
Gene Symbol | Serpina1 |
---|---|
Gene Full Name | serpin family A member 1 |
Alias Symbols | AAT;alpha-1-antiproteinase;Alpha-1-antitrypsin;alpha-1-antitrypsin (protease inhibitor);alpha-1-protease inhibitor;alpha-1-proteinase inhibitor;Pi;serine (or cysteine) proteinase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1;serine (or cysteine) proteinase inhibitor, clade A, member 1;serine protease inhibitor alpha 1;serpin A1;serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1;Spi1. |
NCBI Gene Id | 24648 |
Protein Name | Alpha-1-antiproteinase |
Description of Target | Inhibitor of serine proteases. The primary target is elastase, but also has a moderate affinity for plasmin and thrombin. |
Uniprot ID | P17475 |
Molecular Weight | 46136 MW |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "SERPINA1 Antibody (OABB01837)"?
The tested species reactivity for this item is "Mouse, Rat". This antibody is predicted to have homology to "Mouse|Rat".
-
How long will it take to receive "SERPINA1 Antibody (OABB01837)"?
This item is available "Domestic: within 1-2 week delivery | International: within 1-2 week delivery".
-
What buffer format is "SERPINA1 Antibody (OABB01837)" provided in?
This item is provided in "Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "SERPINA1 Antibody (OABB01837)"?
This target may also be called "AAT;alpha-1-antiproteinase;Alpha-1-antitrypsin;alpha-1-antitrypsin (protease inhibitor);alpha-1-protease inhibitor;alpha-1-proteinase inhibitor;Pi;serine (or cysteine) proteinase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1;serine (or cysteine) proteinase inhibitor, clade A, member 1;serine protease inhibitor alpha 1;serpin A1;serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1;Spi1." in publications.
-
What is the shipping cost for "SERPINA1 Antibody (OABB01837)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "SERPINA1 Antibody (OABB01837)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "SERPINA1 Antibody (OABB01837)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "46136 MW".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "SERPINA1 Antibody (OABB01837)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "Serpina1"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "Serpina1"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "Serpina1"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "Serpina1"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "Serpina1"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "Serpina1"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.