SDHC Antibody - N-terminal region (ARP63455_P050)

Catalog No: ARP63455_P050

Host: Rabbit
Target Name: SDHC
Sample Type: NCI-H226 Whole cell lysates
Antibody Dilution: 1.0ug/ml

Rabbit Anti-SDHC Antibody
Catalog Number: ARP63455_P050
Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue
Observed Staining: Cytoplasmic in mitochondria
Primary Antibody Concentration: 1:100
Other Working Concentrations: 1:600
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20X
Exposure Time: 0.5 - 2.0 sec

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB, IHC
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human SDHC
• Purification: Affinity Purified
• Peptide Sequence: Synthetic peptide located within the following region: MAALLLRHVGRHCLRAHFSPQLCIRNAVPLGTTAKEEMERFWNKNIGSNR
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-SDHC (ARP63455_P050) antibody is Catalog # AAP63455

Target Info

• Gene Symbol: SDHC
• Alias Symbols: CYBL, PGL3, QPS1, SDH3, CYB560
• NCBI Gene Id: 6391
• Description of Target: This gene encodes one of four nuclear-encoded subunits that comprise succinate dehydrogenase, also known as mitochondrial complex II, a key enzyme complex of the tricarboxylic acid cycle and aerobic respiratory chains of mitochondria. The encoded protein is one of two integral membrane proteins that anchor other subunits of the complex, which form the catalytic core, to the inner mitochondrial membrane. There are several related pseudogenes for this gene on different chromosomes. Mutations in this gene have been associated with paragangliomas. Alternatively spliced transcript variants have been described.
• Uniprot ID: Q99643-2
• Protein Size (# AA): 150
• Molecular Weight: 16kDa
• Protein Interactions: MDM2; UBC; XRCC6; ARHGDIA;