NUCB1 Antibody - C-terminal region (P101699_T100)

Data Sheet
 
Product Number P101699_T100
Product Page www.avivasysbio.com/nucb1-antibody-c-terminal-region-p101699-t100.html
Name NUCB1 Antibody - C-terminal region (P101699_T100)
Protein Size (# AA) 459 amino acids
Molecular Weight 54kDa
NCBI Gene Id 84595
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Nucleobindin 1
Description
Alias Symbols Nucb
Peptide Sequence Synthetic peptide located within the following region: SQPDGQLQFRADTGDAPVPAPAGDQKDVPASEKKVPEQPPVLPQLDSQHL
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Wendel,M., et al., 1995, J. Biol. Chem. 270 (11), 6125-6133
Description of Target An extracellular calcium binding protein of the mineralized matrix of bone [Calnuc or RGD:620030]. Also useful as a Golgi marker in immunohistochemistry (1:100 dilution).
Protein Interactions STXBP5L; GNAI3;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-NUCB1 (P101699_T100) antibody
Blocking Peptide For anti-NUCB1 (P101699_T100) antibody is Catalog # AAP32211 (Previous Catalog # AAPP03184)
Immunogen The immunogen is a synthetic peptide corresponding to a region of Rat
Uniprot ID Q63083
Protein Name Nucleobindin-1
Publications

Lin, P. et al. Calnuc binds to Alzheimer’s beta-amyloid precursor protein and affects its biogenesis. J. Neurochem. 100, 1505-14 (2007). 17348862

Protein Accession # NP_445915
Purification Protein A purified
Nucleotide Accession # NM_053463.1
Tested Species Reactivity Human, Rat
Gene Symbol NUCB1
Predicted Species Reactivity Mouse, Rat, Dog
Application IHC
Predicted Homology Based on Immunogen Sequence Dog: 78%; Mouse: 92%; Rat: 100%
Image 1
Rat NRK
Rat NRK
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com