ELK4 Antibody - C-terminal region (P100985_P050)

• Product Number: P100985_P050
• Name: ELK4 Antibody - C-terminal region (P100985_P050)
• Protein Size (# AA): 405 amino acids
• Molecular Weight: 45kDa
• NCBI Gene Id: 2005
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: ELK4, ETS-domain protein (SRF accessory protein 1)
• Alias Symbols: SAP1
• Peptide Sequence: Synthetic peptide located within the following region: FSQVACSLFMVSPLLSFICPFKQIQNLYTQVCFLLLRFVLERLCVTVM
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Mo,Y., (2001) J. Mol. Biol. 314 (3), 495-506
• Description of Target: The ELK4 gene is a member of the Ets family of transcription factors and of the ternary complex factor (TCF) subfamily. Proteins of the TCF subfamily form a ternary complex by binding to the the serum response factor and the serum reponse element in the promoter of the c-fos proto-oncogene. The protein encoded by ELK4 is phosphorylated by the kinases, MAPK1 and MAPK8.This gene is a member of the Ets family of transcription factors and of the ternary complex factor (TCF) subfamily. Proteins of the TCF subfamily form a ternary complex by binding to the the serum response factor and the serum reponse element in the promoter of the c-fos proto-oncogene. The protein encoded by this gene is phosphorylated by the kinases, MAPK1 and MAPK8. Several transcript variants have been described for this gene.
• Protein Interactions: MAPK8; MAPK3; ELAVL1; ID1; MAPK11; MAPK7; SRF; ID2; ID3; FOS; BRCA1; MAPK14;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-ELK4 (P100985_P050) antibody is Catalog # AAP31227 (Previous Catalog # AAPP01972)
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human ELK4
• Uniprot ID: P28324
• Protein Name: ETS domain-containing protein Elk-4
• Protein Accession #: NP_068567
• Purification: Affinity Purified
• Nucleotide Accession #: NM_021795
• Tested Species Reactivity: Human
• Gene Symbol: ELK4
• Predicted Species Reactivity: Human
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Human: 100%
• Image 1: Human HeLa
  
  ELK4 (ELK4, ETS-domain protein (SRF accessory protein 1) Antibody (against the C terminal of ELK4) (50ug) validated by WB using Hela cell lysate at 0.2-1 ug/ml.