TBP Antibody - middle region (P100971_T100)

Data Sheet
 
Product Number P100971_T100
Product Page www.avivasysbio.com/tbp-antibody-middle-region-p100971-t100.html
Name TBP Antibody - middle region (P100971_T100)
Protein Size (# AA) 339 amino acids
Molecular Weight 38kDa
NCBI Gene Id 6908
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name TATA box binding protein
Description
Alias Symbols HDL4, GTF2D, SCA17, TFIID, GTF2D1
Peptide Sequence Synthetic peptide located within the following region: FSSGKMVCTGAKSEEQSRLAARKYARVVQKLGFPAKFLDFKIQNMVGSCD
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Reid,S.J., et al., (2004) Brain Res. Mol. Brain Res. 125 (1-2), 120-128
Description of Target Initiation of transcription by RNA polymerase II requires the activities of more than 70 polypeptides. The protein that coordinates these activities is transcription factor IID (TFIID), which binds to the core promoter to position the polymerase properly, serves as the scaffold for assembly of the remainder of the transcription complex, and acts as a channel for regulatory signals. TFIID is composed of the TATA-binding protein (TBP) and a group of evolutionarily conserved proteins known as TBP-associated factors or TAFs. TAFs may participate in basal transcription, serve as coactivators, function in promoter recognition or modify general transcription factors (GTFs) to facilitate complex assembly and transcription initiation. This gene encodes TBP, the TATA-binding protein. A distinctive feature of TBP is a long string of glutamines in the N-terminal. This region of the protein modulates the DNA binding activity of the C terminus, and modulation of DNA binding affects the rate of transcription complex formation and initiation of transcription. Mutations that expand the number of CAG repeats encoding this polyglutamine tract, and thus increase the length of the polyglutamine string, are associated with spinocerebellar ataxia 17, a neurodegenerative disorder classified as a polyglutamine disease.
Protein Interactions DR1; SSX2IP; GOLGA2; MEF2A; TAF8; GNG12; GNB2; UBC; UBE2I; TAF10; TAF5; HNF4A; E2F1; PAX5; TAF1A; TCEA1; RUVBL2; Abt1; GTF2A2; ICE2; tat; MED26; TBP; TAF6; TAF4; TAF1; SP1; TP53; SNAPC2; SNAPC1; MUC1; Taf1c; Taf1b; GTF2B; HCVgp1; AHR; TAF9B; BTAF1; TAF13;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-TBP (P100971_T100) antibody
Blocking Peptide For anti-TBP (P100971_T100) antibody is Catalog # AAP31331 (Previous Catalog # AAPP02082)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human TBP
Uniprot ID P20226
Protein Name TATA-box-binding protein
Protein Accession # NP_003185
Purification Protein A purified
Nucleotide Accession # NM_003194
Tested Species Reactivity Human
Gene Symbol TBP
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Rabbit, Sheep, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 100%
Image 1
Human Placenta
WB Suggested Anti-TBP Antibody Titration: 2.5ug/ml
Positive Control: Human Placenta
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com