Product Number |
P100961_T100 |
Product Page |
www.avivasysbio.com/snapc2-antibody-middle-region-p100961-t100.html |
Name |
SNAPC2 Antibody - middle region (P100961_T100) |
Protein Size (# AA) |
334 amino acids |
Molecular Weight |
36kDa |
Subunit |
2 |
NCBI Gene Id |
6618 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
Small nuclear RNA activating complex, polypeptide 2, 45kDa |
Description |
|
Alias Symbols |
SNAP45, PTFDELTA |
Peptide Sequence |
Synthetic peptide located within the following region: STEEDFAVDFEKIYKYLSSVSRSGRSPELSAAESAVVLDLLMSLPEELPL |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Acierno,J.S. et al., () Genomics 73 (2), 203-210 -2001 |
Description of Target |
SNAPc is involved in transcription by two types of polymerases; it is required for transcription of both the RNA polymerase II and III small-nuclear RNA genes and binds specifically to the proximal sequence element PSE, a non-TATA-box basal promoter element common to these two types of genes. In addition, SNAPc is composed of at least three TAFs, SNAP43, SNAP45 and SNAP50. |
Protein Interactions |
TBP; SNAPC4; SNAPC3; SNAPC1; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-SNAPC2 (P100961_T100) antibody |
Blocking Peptide |
For anti-SNAPC2 (P100961_T100) antibody is Catalog # AAP31319 (Previous Catalog # AAPP08633) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human SNAPC2 |
Uniprot ID |
Q13487 |
Protein Name |
snRNA-activating protein complex subunit 2 |
Protein Accession # |
NP_003074 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_003083 |
Tested Species Reactivity |
Human |
Gene Symbol |
SNAPC2 |
Predicted Species Reactivity |
Human |
Application |
IHC, WB |
Predicted Homology Based on Immunogen Sequence |
Human: 100% |
Image 1 | Human kidney
| Immunohistochemistry with Human kidney lysate tissue |
| Image 2 | Human Jurkat
| WB Suggested Anti-SNAPC2 Antibody Titration: 1.25ug/ml Positive Control: Jurkat cell lysate |
|
|