E2F5 Antibody - N-terminal region (P100920_P050)

Data Sheet
 
Product Number P100920_P050
Product Page www.avivasysbio.com/e2f5-antibody-n-terminal-region-p100920-p050.html
Name E2F5 Antibody - N-terminal region (P100920_P050)
Protein Size (# AA) 346 amino acids
Molecular Weight 38kDa
NCBI Gene Id 1875
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name E2F transcription factor 5, p130-binding
Description
Alias Symbols E2F-5
Peptide Sequence Synthetic peptide located within the following region: KAEIEDLELKERELDQQKLLLQQSIKNVMDDSINNRFSYVTHEDICNCFN
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Ohtani,N., et al., (2003) J. Cell Biol. 162 (2), 173-183
Description of Target E2F5 is a member of the E2F family of transcription factors. The E2F family plays a crucial role in the control of cell cycle and action of tumor suppressor proteins and is also a target of the transforming proteins of small DNA tumor viruses. The E2F proteins contain several evolutionally conserved domains found in most members of the family. These domains include a DNA binding domain, a dimerization domain which determines interaction with the differentiation regulated transcription factor proteins (DP), a transactivation domain enriched in acidic amino acids, and a tumor suppressor protein association domain which is embedded within the transactivation domain. This protein is differentially phosphorylated and is expressed in a wide variety of human tissues. It is more homologous to E2F4, a family member, than to other members. Both this protein and E2F4 interact with tumor suppressor proteins p130 and p107, but not with pRB.
Protein Interactions RBL2; UBC; KMT2D; BRCC3; SMAD3; EP300; XPO1; CREBBP; TFDP1; RBL1; BIRC5; MYC; MT1G;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-E2F5 (P100920_P050) antibody
Blocking Peptide For anti-E2F5 (P100920_P050) antibody is Catalog # AAP31273 (Previous Catalog # AAPP02022)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human E2F5
Uniprot ID Q15329
Protein Name Transcription factor E2F5
Protein Accession # NP_001942
Purification Affinity Purified
Nucleotide Accession # NM_001951
Tested Species Reactivity Human
Gene Symbol E2F5
Predicted Species Reactivity Human, Mouse, Rat, Dog, Guinea Pig, Rabbit, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 84%
Image 1
Human Jurkat Whole Cell
Host: Rabbit
Target Name: E2F5
Sample Tissue: Human Jurkat Whole Cell
Antibody Dilution: 1ug/ml
Image 2
Human Jurkat
WB Suggested Anti-E2F5 Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com