Product Number |
P100920_P050 |
Product Page |
www.avivasysbio.com/e2f5-antibody-n-terminal-region-p100920-p050.html |
Name |
E2F5 Antibody - N-terminal region (P100920_P050) |
Protein Size (# AA) |
346 amino acids |
Molecular Weight |
38kDa |
NCBI Gene Id |
1875 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
E2F transcription factor 5, p130-binding |
Description |
|
Alias Symbols |
E2F-5 |
Peptide Sequence |
Synthetic peptide located within the following region: KAEIEDLELKERELDQQKLLLQQSIKNVMDDSINNRFSYVTHEDICNCFN |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Ohtani,N., et al., (2003) J. Cell Biol. 162 (2), 173-183 |
Description of Target |
E2F5 is a member of the E2F family of transcription factors. The E2F family plays a crucial role in the control of cell cycle and action of tumor suppressor proteins and is also a target of the transforming proteins of small DNA tumor viruses. The E2F proteins contain several evolutionally conserved domains found in most members of the family. These domains include a DNA binding domain, a dimerization domain which determines interaction with the differentiation regulated transcription factor proteins (DP), a transactivation domain enriched in acidic amino acids, and a tumor suppressor protein association domain which is embedded within the transactivation domain. This protein is differentially phosphorylated and is expressed in a wide variety of human tissues. It is more homologous to E2F4, a family member, than to other members. Both this protein and E2F4 interact with tumor suppressor proteins p130 and p107, but not with pRB. |
Protein Interactions |
RBL2; UBC; KMT2D; BRCC3; SMAD3; EP300; XPO1; CREBBP; TFDP1; RBL1; BIRC5; MYC; MT1G; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-E2F5 (P100920_P050) antibody |
Blocking Peptide |
For anti-E2F5 (P100920_P050) antibody is Catalog # AAP31273 (Previous Catalog # AAPP02022) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human E2F5 |
Uniprot ID |
Q15329 |
Protein Name |
Transcription factor E2F5 |
Protein Accession # |
NP_001942 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_001951 |
Tested Species Reactivity |
Human |
Gene Symbol |
E2F5 |
Predicted Species Reactivity |
Human, Mouse, Rat, Dog, Guinea Pig, Rabbit, Zebrafish |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 84% |
Image 1 | Human Jurkat Whole Cell
| Host: Rabbit Target Name: E2F5 Sample Tissue: Human Jurkat Whole Cell Antibody Dilution: 1ug/ml |
|
Image 2 | Human Jurkat
| WB Suggested Anti-E2F5 Antibody Titration: 0.2-1 ug/ml Positive Control: Jurkat cell lysate |
|