| Product Number |
P100902_T100 |
| Product Page |
www.avivasysbio.com/znf174-antibody-n-terminal-region-p100902-t100.html |
| Name |
ZNF174 Antibody - N-terminal region (P100902_T100) |
| Protein Size (# AA) |
407 amino acids |
| Molecular Weight |
46kDa |
| NCBI Gene Id |
7727 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Zinc finger protein 174 |
| Description |
|
| Alias Symbols |
ZSCAN8 |
| Peptide Sequence |
Synthetic peptide located within the following region: MAAKMEITLSSNTEASSKQERHIIAKLEEKRGPPLQKNCPDPELCRQSFR |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Stone, J.R., et al., (2002) J. Biol. Chem. 277 (7), 5448-5452. |
| Description of Target |
Zinc finger protein 174. |
| Protein Interactions |
CDK6; SUMO1; MZF1; ZSCAN32; ZNF174; ZNF20; ZNF24; ZKSCAN8; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-ZNF174 (P100902_T100) antibody |
| Blocking Peptide |
For anti-ZNF174 (P100902_T100) antibody is Catalog # AAP31250 (Previous Catalog # AAPP01995) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF174 |
| Uniprot ID |
Q15697 |
| Protein Name |
Zinc finger protein 174 |
| Protein Accession # |
NP_003441 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_003450 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
ZNF174 |
| Predicted Species Reactivity |
Human, Guinea Pig, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Guinea Pig: 78%; Human: 100%; Rabbit: 78% |
| Image 1 | Jurkat, HepG2
 | Host: Rabbit
Target Name: ZNF174
Sample Type: Lane:
A. Jurkat
B.HepG2
Antibody Dilution: A. 2.5 ug/ml
B. 2.5ug/ml |
|
|
