GTF2H2 Antibody - middle region (P100894_P050)

Data Sheet
 
Product Number P100894_P050
Product Page www.avivasysbio.com/gtf2h2-antibody-middle-region-p100894-p050.html
Name GTF2H2 Antibody - middle region (P100894_P050)
Protein Size (# AA) 395 amino acids
Molecular Weight 44kDa
Subunit 2
NCBI Gene Id 2966
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name General transcription factor IIH, polypeptide 2, 44kDa
Description
Alias Symbols p44, BTF2, TFIIH, BTF2P44, T-BTF2P44
Peptide Sequence Synthetic peptide located within the following region: HHLFPLDAFQEIPLEEYNGERFCYGCQGELKDQHVYVCAVCQNVFCVDCD
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Ren,P., (2007) Am. J. Respir. Crit. Care Med. 175 (11), 1151-1157
Description of Target GTF2H2 gene is part of a 500 kb inverted duplication on chromosome 5q13. This duplicated region contains at least four genes and repetitive elements which make it prone to rearrangements and deletions. The repetitiveness and complexity of the sequence hav
Protein Interactions UBC; CDK7; GTF2H5; GTF2H1; SRA1; GTF2H4; GTF2H3; UBD; COPS2; ERCC3; ERCC8; ERCC2; AR; MNAT1; CCNH;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-GTF2H2 (P100894_P050) antibody
Blocking Peptide For anti-GTF2H2 (P100894_P050) antibody is Catalog # AAP31242
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human GTF2H2
Uniprot ID Q13888
Protein Name General transcription factor IIH subunit 2
Protein Accession # NP_001506
Purification Affinity Purified
Nucleotide Accession # NM_001515
Tested Species Reactivity Human
Gene Symbol GTF2H2
Predicted Species Reactivity Human, Mouse, Dog, Horse, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Dog: 92%; Horse: 92%; Human: 100%; Mouse: 85%; Zebrafish: 85%
Image 1
Human 293T
Host: Rabbit
Target Name: GTF2H2
Sample Tissue: Human 293T
Antibody Dilution: 1.0ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com