| Product Number |
P100884_T100 |
| Product Page |
www.avivasysbio.com/lhx2-antibody-middle-region-p100884-t100.html |
| Name |
LHX2 Antibody - middle region (P100884_T100) |
| Protein Size (# AA) |
406 amino acids |
| Molecular Weight |
44kDa |
| NCBI Gene Id |
9355 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
LIM homeobox 2 |
| Description |
|
| Alias Symbols |
LH2, hLhx2 |
| Peptide Sequence |
Synthetic peptide located within the following region: AEHLDRDQPYPSSQKTKRMRTSFKHHQLRTMKSYFAINHNPDAKDLKQLA |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Glenn,D.J., et al., (1999) J. Biol. Chem. 274 (51), 36159-36167 |
| Description of Target |
LHX2 is a protein belonging to a large protein family, members of which carry the LIM domain, a unique cysteine-rich zinc-binding domain. The encoded protein may function as a transcriptional regulator. The protein can recapitulate or rescue phenotypes in Drosophila caused by a related protein, suggesting conservation of function during evolution. |
| Protein Interactions |
LDB1; CITED2; RLIM; MSX1; PAX6; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-LHX2 (P100884_T100) antibody |
| Blocking Peptide |
For anti-LHX2 (P100884_T100) antibody is Catalog # AAP31207 (Previous Catalog # AAPP01951) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human LHX2 |
| Uniprot ID |
P50458 |
| Protein Name |
LIM/homeobox protein Lhx2 |
| Protein Accession # |
NP_004780 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_004789 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
LHX2 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100% |
| Image 1 | Human HepG2
 | WB Suggested Anti-LHX2 Antibody Titration: 2.5ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2 cell lysate |
|
|
