Product Number |
P100839_T100 |
Product Page |
www.avivasysbio.com/hlx1-antibody-middle-region-p100839-t100.html |
Name |
HLX1 Antibody - middle region (P100839_T100) |
Protein Size (# AA) |
488 amino acids |
Molecular Weight |
51kDa |
NCBI Gene Id |
3142 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
H2.0-like homeobox |
Description |
|
Alias Symbols |
HB24, HLX1 |
Peptide Sequence |
Synthetic peptide located within the following region: PGPYAVLTKDTMPQTYKRKRSWSRAVFSNLQRKGLEKRFEIQKYVTKPDR |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Kennedy, M.A., et al., (1994) Genomics 22 (2), 348-355. |
Description of Target |
H2.0-like homeo box 1; H2.0 (Drosophilia)-like homeo box-1. |
Protein Interactions |
UBC; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-HLX (P100839_T100) antibody |
Other Applications Image 1 Data |
Sample Type: Xenopus Laevis embryo stage 46 gut tissue Primary Dilution: 1:200
|
Blocking Peptide |
For anti-HLX (P100839_T100) antibody is Catalog # AAP31195 (Previous Catalog # AAPP01938) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human HLX1 |
Uniprot ID |
Q14774 |
Protein Name |
H2.0-like homeobox protein |
Publications |
Homeobox gene HLX is a regulator of HGF/c-met-mediated migration of human trophoblast-derived cell lines. Biol Reprod. 83, 676-83 (2010). 20554918
The H2.0-like homeobox transcription factor modulates yolk sac vascular remodeling in mouse embryos. Arterioscler Thromb Vasc Biol. 34, 1468-76 (2014). 24764455 |
Protein Accession # |
NP_068777 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_021958 |
Tested Species Reactivity |
Human, Frog |
Gene Symbol |
HLX |
Predicted Species Reactivity |
Zebrafish |
Application |
IF, WB |
Predicted Homology Based on Immunogen Sequence |
Zebrafish: 92% |
Image 1 | Human Ovary Tumor
| Host: Rabbit Target Name: HLX1 Sample Tissue: Human Ovary Tumor Antibody Dilution: 1.0ug/ml |
|
Image 2 | Xenopus Laevis
| Sample Type: Xenopus Laevis embryo stage 46 gut tissue Primary Dilution: 1:200 |
|