Product Number |
P100836_P050 |
Product Page |
www.avivasysbio.com/gcm1-antibody-n-terminal-region-p100836-p050.html |
Name |
GCM1 Antibody - N-terminal region (P100836_P050) |
Protein Size (# AA) |
436 amino acids |
Molecular Weight |
49 kDa |
NCBI Gene Id |
8521 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Glial cells missing homolog 1 (Drosophila) |
Description |
|
Alias Symbols |
GCMA, hGCMa |
Peptide Sequence |
Synthetic peptide located within the following region: MEPDDFDSEDKEILSWDINDVKLPQNVKKTDWFQEWPDSYAKHIYSSEDK |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Yu,C., et al., (2002) J. Biol. Chem. 277 (51), 50062-50068 |
Description of Target |
GCM1 is a DNA-binding protein with a gcm-motif (glial cell missing motif). The encoded protein is a homolog of the Drosophila glial cells missing gene (gcm). This protein binds to the GCM-motif (A/G)CCCGCAT, a novel sequence among known targets of DNA-binding proteins. The N-terminal DNA-binding domain confers the unique DNA-binding activity of this protein.This gene encodes a DNA-binding protein with a gcm-motif (glial cell missing motif). The encoded protein is a homolog of the Drosophila glial cells missing gene (gcm). This protein binds to the GCM-motif (A/G)CCCGCAT, a novel sequence among known targets of DNA-binding proteins. The N-terminal DNA-binding domain confers the unique DNA-binding activity of this protein. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-132 D88613.1 1-132 133-2763 AB026493.1 1-2631 |
Protein Interactions |
FBXW2; UBC; SENP1; CAMK1; SUMO1; DUSP23; CREBBP; HDAC5; HDAC4; HDAC3; HDAC1; CUL1; SKP1; UBE2I; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Enhanced Validation |
Relative Expression (Western Blot) |
|
|
Datasheets/Manuals |
Printable datasheet for anti-GCM1 (P100836_P050) antibody |
Blocking Peptide |
For anti-GCM1 (P100836_P050) antibody is Catalog # AAP31192 (Previous Catalog # AAPP01935) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human GCM1 |
Uniprot ID |
Q9NP62 |
Protein Name |
Chorion-specific transcription factor GCMa |
Publications |
Augmented trophoblast cell death in preeclampsia can proceed via ceramide-mediated necroptosis. Cell Death Dis. 8, e2590 (2017). 28151467
Baczyk, D. et al. Glial cell missing-1 transcription factor is required for the differentiation of the human trophoblast. Cell Death Differ. 16, 719-27 (2009). 19219068
Gene Expression Profiling Reveals a Novel Regulatory Role for Sox21 Protein in Mouse Trophoblast Stem Cell Differentiation. J. Biol. Chem. 290, 30152-62 (2015). 26491013
Kumar, P., Luo, Y., Tudela, C., Alexander, J. M. & Mendelson, C. R. The c-Myc-regulated microRNA-17~92 (miR-17~92) and miR-106a~363 clusters target hCYP19A1 and hGCM1 to inhibit human trophoblast differentiation. Mol. Cell. Biol. 33, 1782-96 (2013). 23438603
Sivasubramaniyam, T. et al. Where polarity meets fusion: role of Par6 in trophoblast differentiation during placental development and preeclampsia. Endocrinology 154, 1296-309 (2013). 23341197 |
Protein Accession # |
NP_003634 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_003643 |
Tested Species Reactivity |
Human |
Gene Symbol |
GCM1 |
Predicted Species Reactivity |
Human |
Application |
IHC, WB |
Predicted Homology Based on Immunogen Sequence |
Dog: 78%; Human: 92%; Mouse: 78%; Rat: 78% |
Image 1 | Human Lung
| Human Lung |
|
Image 2 | Human Spleen
| Human Spleen |
|
Image 3 | Human 293T
| Host: Rabbit Target Name: GCM1 Sample Tissue: Human 293T Antibody Dilution: 1.0ug/ml |
|
Image 4 | Human THP-1 Whole Cell
| Host: Rabbit Target Name: GCM1 Sample Tissue: Human THP-1 Whole Cell Antibody Dilution: 0.5ug/ml |
|
Image 5 | Western Blot
| 25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment. |
|