TFDP1 Antibody - N-terminal region (P100820_P050)

Data Sheet
 
Product Number P100820_P050
Product Page www.avivasysbio.com/tfdp1-antibody-n-terminal-region-p100820-p050.html
Name TFDP1 Antibody - N-terminal region (P100820_P050)
Protein Size (# AA) 410 amino acids
Molecular Weight 45kDa
NCBI Gene Id 7027
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Transcription factor Dp-1
Description
Alias Symbols DP1, DILC, Dp-1, DRTF1
Peptide Sequence Synthetic peptide located within the following region: VIGTPQRPAASNTLVVGSPHTPSTHFASQNQPSDSSPWSAGKRNRKGEKN
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Yasui,K., et al., (2003) J. Hum. Genet. 48 (12), 609-613
Description of Target The E2F transcription factor family regulates the expression of various cellular promoters, particularly those involved in the cell cycle. E2F factors bind to DNA as homodimers or heterodimers in association with dimerization partner DP1. TFDP1 may be the first example of a family of related transcription factors and may have a role in progression of some hepatocellular carcinomas by promoting growth of the tumor cells.
Protein Interactions UBC; E2F6; E2F4; SIAH1; E2F3; E2F2; E2F1; CDK6; PRPF31; CDK2; CDK1; SOCS3; RB1; PCGF6; RYBP; YAF2; RNF2; ELAVL1; LIN9; LIN54; LIN37; RBL2; SERTAD2; NPDC1; E2F5; TP53; RBL1; CDK3; TP53BP1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-TFDP1 (P100820_P050) antibody
Blocking Peptide For anti-TFDP1 (P100820_P050) antibody is Catalog # AAP31168 (Previous Catalog # AAPP01911)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human TFDP1
Uniprot ID Q14186
Protein Name Transcription factor Dp-1
Protein Accession # NP_009042
Purification Affinity Purified
Nucleotide Accession # NM_007111
Tested Species Reactivity Human
Gene Symbol TFDP1
Predicted Species Reactivity Human, Mouse, Cow
Application IF, IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 92%; Human: 100%; Mouse: 92%
Image 1
HCT116
Sample Type:
HCT116
Primary Antibody Dilution:
4 ug/ml
Secondary Antibody:
Anti-rabbit Alexa 546
Secondary Antibody Dilution:
2 ug/ml
Gene Name:
TFDP1
Image 2
Human Liver
WB Suggested Anti-TFDP1 Antibody Titration: 0.2-1 ug/ml
Positive Control: Human Liver
Image 3
Human Intestine
Human Intestine
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com