TFEB Antibody - middle region (P100809_P050)

Data Sheet
 
Product Number P100809_P050
Product Page www.avivasysbio.com/tfeb-antibody-middle-region-p100809-p050.html
Name TFEB Antibody - middle region (P100809_P050)
Protein Size (# AA) 476 amino acids
Molecular Weight 53 kDa
NCBI Gene Id 7942
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Transcription factor EB
Description
Alias Symbols TCFEB, BHLHE35, ALPHATFEB
Peptide Sequence Synthetic peptide located within the following region: IKELGMLIPKANDLDVRWNKGTILKASVDYIRRMQKDLQKSRELENHSRR
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Carr,C.S., et al., (1990) Mol. Cell. Biol. 10 (8), 4384-4388
Description of Target The TFEB gene fuses with an intronless gene in renal tumors harboring the t(6;11)(p21;q13) chromosome translocation. It encodes a protein that is a highly sensitive and specific diagnostic marker for renal neoplasms.
Protein Interactions SRPK1; YWHAQ; TFEC; TFE3; MITF;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Enhanced Validation
Relative Expression (Western Blot) Avivasheild
Datasheets/Manuals Printable datasheet for anti-TFEB (P100809_P050) antibody
Blocking Peptide For anti-TFEB (P100809_P050) antibody is Catalog # AAP31151 (Previous Catalog # AAPP01890)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human TFEB
Uniprot ID P19484-2
Protein Name Transcription factor EB
Purification Affinity Purified
Tested Species Reactivity Human
Gene Symbol TFEB
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Pig, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 92%; Goat: 100%; Guinea Pig: 92%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
Image 1
Human Lung Tumor
Host: Rabbit
Target Name: TFEB
Sample Tissue: Human Lung Tumor
Antibody Dilution: 1.0ug/ml
Image 2
Western Blot
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 0.5 ug/mL of the antibody was used in this experiment.
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com