Product Number |
P100809_P050 |
Product Page |
www.avivasysbio.com/tfeb-antibody-middle-region-p100809-p050.html |
Name |
TFEB Antibody - middle region (P100809_P050) |
Protein Size (# AA) |
476 amino acids |
Molecular Weight |
53 kDa |
NCBI Gene Id |
7942 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Transcription factor EB |
Description |
|
Alias Symbols |
TCFEB, BHLHE35, ALPHATFEB |
Peptide Sequence |
Synthetic peptide located within the following region: IKELGMLIPKANDLDVRWNKGTILKASVDYIRRMQKDLQKSRELENHSRR |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Carr,C.S., et al., (1990) Mol. Cell. Biol. 10 (8), 4384-4388 |
Description of Target |
The TFEB gene fuses with an intronless gene in renal tumors harboring the t(6;11)(p21;q13) chromosome translocation. It encodes a protein that is a highly sensitive and specific diagnostic marker for renal neoplasms. |
Protein Interactions |
SRPK1; YWHAQ; TFEC; TFE3; MITF; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Enhanced Validation |
Relative Expression (Western Blot) |
|
|
Datasheets/Manuals |
Printable datasheet for anti-TFEB (P100809_P050) antibody |
Blocking Peptide |
For anti-TFEB (P100809_P050) antibody is Catalog # AAP31151 (Previous Catalog # AAPP01890) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human TFEB |
Uniprot ID |
P19484-2 |
Protein Name |
Transcription factor EB |
Purification |
Affinity Purified |
Tested Species Reactivity |
Human |
Gene Symbol |
TFEB |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Pig, Rabbit |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 92%; Goat: 100%; Guinea Pig: 92%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100% |
Image 1 | Human Lung Tumor
| Host: Rabbit Target Name: TFEB Sample Tissue: Human Lung Tumor Antibody Dilution: 1.0ug/ml |
|
Image 2 | Western Blot
| 25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 0.5 ug/mL of the antibody was used in this experiment. |
|