TAF1A Antibody - N-terminal region (P100801_T100)

Data Sheet
 
Product Number P100801_T100
Product Page www.avivasysbio.com/taf1a-antibody-n-terminal-region-p100801-t100.html
Name TAF1A Antibody - N-terminal region (P100801_T100)
Protein Size (# AA) 450 amino acids
Molecular Weight 53kDa
Subunit A
NCBI Gene Id 9015
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name TATA box binding protein (TBP)-associated factor, RNA polymerase I, A, 48kDa
Description
Alias Symbols SL1, RAFI48, TAFI48, MGC:17061
Peptide Sequence Synthetic peptide located within the following region: CLSFIQEALLKHQWQQAAEYMYSYFQTLEDSDSYKRQAAPEIIWKLGSEI
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Di Pietro, C., et al., (2000) Cytogenet. Cell Genet. 89 (1-2) 133-136.
Description of Target Initiation of transcription by RNA polymerase I requires the formation of a complex composed of the TATA-binding protein (TBP) and three TBP-associated factors (TAFs) specific for RNA polymerase I. This complex, also known as SL1, binds to the core promoter of ribosomal RNA genes to position the polymerase properly and acts as a channel for regulatory signals. This gene encodes the smallest SL1-specific TAF. Two transcripts encoding different isoforms have been identified.
Protein Interactions C11orf57; JMJD6; TBP; Taf1c; Taf1b; BKRF1; UBC; TAF12; TAF1D; HIST1H4A; HIST1H3A; HIST2H2BE; HIST2H2AC; ESR1; SET; TAF1A; RUNX2; TP53; CD3EAP; HIST4H4; HIST3H3; ANP32A; UBTF; RRN3; MYC;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-TAF1A (P100801_T100) antibody
Blocking Peptide For anti-TAF1A (P100801_T100) antibody is Catalog # AAP31143 (Previous Catalog # AAPP01882)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human TAF1A
Uniprot ID Q15573
Protein Name TATA box-binding protein-associated factor RNA polymerase I subunit A
Sample Type Confirmation

TAF1A is supported by BioGPS gene expression data to be expressed in Raji

Protein Accession # NP_005672
Purification Protein A purified
Nucleotide Accession # NM_005681
Tested Species Reactivity Human
Gene Symbol TAF1A
Predicted Species Reactivity Human, Mouse, Rat, Dog, Horse, Pig, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Dog: 92%; Horse: 85%; Human: 100%; Mouse: 85%; Pig: 78%; Rabbit: 85%; Rat: 78%
Image 1
Human Raji
Host: Rabbit
Target Name: TAF(I)48
Sample Type: Raji Cell
Antibody Dilution: 1.0ug/mlTAF1A is supported by BioGPS gene expression data to be expressed in Raji
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com