| Product Number |
P100780_P050 |
| Product Page |
www.avivasysbio.com/nfe2l1-antibody-middle-region-p100780-p050.html |
| Name |
NFE2L1 Antibody - middle region (P100780_P050) |
| Protein Size (# AA) |
772 amino acids |
| Molecular Weight |
85kDa |
| NCBI Gene Id |
4779 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Nuclear factor (erythroid-derived 2)-like 1 |
| Description |
|
| Alias Symbols |
NRF1, TCF11, LCR-F1 |
| Peptide Sequence |
Synthetic peptide located within the following region: HTYNMAPSALDSADLPPPSALKKGSKEKQADFLDKQMSRDEHRARAMKIP |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Wang,W., (2007) J. Biol. Chem. 282 (34), 24670-24678 |
| Description of Target |
NFE2L1 activates erythroid-specific, globin gene expression. This gene encodes a protein that is involved in globin gene expression in erythrocytes. Confusion has occurred in bibliographic databases due to the shared symbol of NRF1 for this gene, NFE2L1, and for 'nuclear respiratory factor 1' which has an official symbol of NRF1. Sequence Note: The RefSeq transcript and protein were derived from transcript and genomic sequence to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on alignments. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-256 DB097304.1 1-256 257-603 DA230932.1 224-570 604-1464 AK090459.1 569-1429 1465-3372 U08853.1 199-2106 3373-4349 AC004477.2 104176-105152 4350-4891 BM983473.1 1-542 c |
| Protein Interactions |
UBC; KEAP1; NFE2L1; MAFG; BACH2; CREBZF; MAFF; NFE2L3; FBXW7; GSK3B; CAPN1; CD6; SUMO2; HCFC1; ATF4; MAFK; JUND; JUNB; JUN; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-NFE2L1 (P100780_P050) antibody |
| Blocking Peptide |
For anti-NFE2L1 (P100780_P050) antibody is Catalog # AAPP01949 |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human NFE2L1 |
| Uniprot ID |
Q14494 |
| Protein Name |
Nuclear factor erythroid 2-related factor 1 |
| Protein Accession # |
NP_003195 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_003204 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
NFE2L1 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Human: 100%; Mouse: 100%; Rat: 100% |
| Image 1 | Human Jurkat
 | NFE2L1 (nuclear factor (erythroid-derived 2)-like 1) Antibody (against the middle region of NFE2L1) (50ug) validated by WB using Jurkat cell lysate at 0.2-1 ug/ml. |
|
| Image 2 | Human HepG2 Whole Cell
 | Host: Rabbit
Target Name: NFE2L1
Sample Tissue: Human HepG2 Whole Cell
Antibody Dilution: 1ug/ml |
|
