TCF4 Antibody - N-terminal region (P100776_P050)

Data Sheet
 
Product Number P100776_P050
Product Page www.avivasysbio.com/tcf4-antibody-n-terminal-region-p100776-p050.html
Name TCF4 Antibody - N-terminal region (P100776_P050)
Protein Size (# AA) 667 amino acids
Molecular Weight 71 kDa
NCBI Gene Id 6925
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Transcription factor 4
Description
Alias Symbols E2-2, ITF2, PTHS, SEF2, CDG2T, FECD3, ITF-2, SEF-2, TCF-4, SEF2-1, SEF2-1A, SEF2-1B, SEF2-1D, bHLHb19
Peptide Sequence Synthetic peptide located within the following region: DGTPYDHMTSRDLGSHDNLSPPFVNSRIQSKTERGSYSSYGRESNLQGCH
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Raurell,I., (2006) J. Biol. Chem. 281 (3), 1401-1411
Description of Target TCF4 encodes transcription factor 4, a basic helix-turn-helix transcription factor. The protein recognizes an Ephrussi-box ('E-box') binding site ('CANNTG') - a motif first identified in immunoglobulin enhancers. TCF4 is expressed predominantly in pre-B-cells, although it is found in other tissues as well.TCF4 encodes transcription factor 4, a basic helix-turn-helix transcription factor. The protein recognizes an Ephrussi-box ('E-box') binding site ('CANNTG') - a motif first identified in immunoglobulin enhancers. TCF4 is expressed predominantly in pre-B-cells, although it is found in other tissues as well. TCF4 is known to produce multiple transcripts; however as the complete structure is only known for the transcript that encodes the b isoform, that is the variant presented here.
Protein Interactions GOLGA8F; REXO1L6P; FAM74A4; GOLGA8EP; C9orf171; RAB41; SEC14L4; NEK8; ZDHHC24; MSRB3; FERD3L; PPP1R18; NUDT10; PATE1; TMEM213; KLC3; ZNF417; NEU4; NR2C2AP; POLR1A; SZT2; EPB41L3; MAPKBP1; SLC4A1AP; FRS3; NEK6; GLRX3; MAD2L2; BCAS2; TSSC4; CHAF1A; POLR1C;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-TCF4 (P100776_P050) antibody
Blocking Peptide For anti-TCF4 (P100776_P050) antibody is Catalog # AAP31106 (Previous Catalog # AAPP01845)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human TCF4
Uniprot ID P15884
Protein Name Transcription factor 4
Protein Accession # NP_003190
Purification Affinity Purified
Nucleotide Accession # NM_003199
Tested Species Reactivity Human
Gene Symbol TCF4
Predicted Species Reactivity Human, Mouse, Rat, Guinea Pig, Horse, Pig
Application WB
Predicted Homology Based on Immunogen Sequence Guinea Pig: 92%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%
Image 1
human neuroblastoma
TCF4 antibody - N-terminal region (P100776_P050) validated by WB using 1. SHSY-5Y lysate (15ug) at 1:100.
sH-SY5Y cell lysate;no + transfected hTCF4;yes (human neuroblastoma cells)
Image 2

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment.
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com