HOXA10 Antibody - N-terminal region (P100767_T100)

• Product Number: P100767_T100
• Name: HOXA10 Antibody - N-terminal region (P100767_T100)
• Protein Size (# AA): 393 amino acids
• Molecular Weight: 41kDa
• NCBI Gene Id: 3206
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Gene Full Name: Homeobox A10
• Description:
  View product citations for HOXA10 Antibody - N-terminal region (P100767_T100)on CiteAb
• Alias Symbols: PL, HOX1, HOX1H, HOX1.8
• Peptide Sequence: Synthetic peptide located within the following region: MSCSESPAANSFLVDSLISSGRGEAGGGGGGAGGGGGGGYYAHGGVYLPP
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Akbas,G.E., et al., (2004) Mol. Biol. 340 (5), 1013-1023
• Description of Target: In vertebrates, the genes encoding the class of transcription factors called homeobox genes are found in clusters named A, B, C, and D on four separate chromosomes. Expression of these proteins is spatially and temporally regulated during embryonic development. HOXA10 is part of the A cluster on chromosome 7 and encodes a DNA-binding transcription factor which may regulate gene expression, morphogenesis, and differentiation. More specifically, it may function in fertility, embryo viability, and regulation of hematopoietic lineage commitment.
• Protein Interactions: SPI1; COPS5; CREBBP; PBX1; SNAPC1; EMX1; POLR3D; SIRT2; GMNN; EP300; MEIS1; PTPN6; HOXA10; FOXO1;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-HOXA10 (P100767_T100) antibody is Catalog # AAP31094 (Previous Catalog # AAPP01833)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human HOXA10
• Uniprot ID: P31260
• Protein Name: Homeobox protein Hox-A10
• Publications:

  Ko, S. Y., Lengyel, E. & Naora, H. The Müllerian HOXA10 gene promotes growth of ovarian surface epithelial cells by stimulating epithelial-stromal interactions. Mol. Cell. Endocrinol. 317, 112-9 (2010). 20036708

• Protein Accession #: NP_061824
• Purification: Protein A purified
• Nucleotide Accession #: NM_018951
• Tested Species Reactivity: Human
• Gene Symbol: HOXA10
• Predicted Species Reactivity: Human, Mouse, Dog, Rabbit
• Application: IHC, WB
• Predicted Homology Based on Immunogen Sequence: Dog: 85%; Human: 92%; Mouse: 78%; Rabbit: 85%
• Image 1: Human HepG2
  
  WB Suggested Anti-HOXA10 Antibody Titration: 1.25ug/ml
  Positive Control: HepG2 cell lysate
• Image 2: Human Muscle
  
  Human Muscle