website statistics
Product Datasheet: P100751_P050 - ETS2 Antibody - C-terminal region (P100751_P050) - Aviva Systems Biology
ETS2 Antibody - C-terminal region (P100751_P050)
Data Sheet
Product Number P100751_P050
Product Page
Product Name ETS2 Antibody - C-terminal region (P100751_P050)
Size 100 ul
Gene Symbol ETS2
Alias Symbols ETS2IT1
Protein Size (# AA) 469 amino acids
Molecular Weight 53kDa
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
NCBI Gene Id 2114
Host Rabbit
Clonality Polyclonal
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Official Gene Full Name V-ets erythroblastosis virus E26 oncogene homolog 2 (avian)
Description This is a rabbit polyclonal antibody against ETS2. It was validated on Western Blot using a cell lysate as a positive control. Aviva Systems Biology strives to provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (
Peptide Sequence Synthetic peptide located within the following region: FESFEDDCSQSLCLNKPTMSFKDYIQERSDPVEQGKPVIPAAVLAGFTGS
Target Reference Geng,C.D. (2005) J. Biol. Chem. 280 (52), 43264-43271/ Yoshimatsu, Y. (2011) J. Cell. Sci. 124, 2753-2762
Description of Target ETS2 contains an ETS DNA-binding domain and belongs to the ETS family. ETS2 is a target of protein kinase C and upregulates GM-CSF. Ets2 and its targets play essential roles in endothelial cell function. Coexpression of Ets-2 and SRC-1 significantly associated with the rate of recurrence and HER expression in breast cancer. Overexpression of ETS2 is associated with human esophageal squamous cell carcinoma. ETS transcriptions factors, such as ETS2, regulate numerous genes and are involved in stem cell development, cell senescence and death, and tumorigenesis. The conserved ETS domain within these proteins is a winged helix-turn-helix DNA-binding domain that recognizes the core consensus DNA sequence GGAA/T of target genes (Dwyer et al., 2007 [PubMed 17986575]).[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Additional Information IHC Information: Paraffin embedded breast tissue, tested with an antibody dilution of 5 ug/ml.
Lead Time Domestic: within 1-2 days delivery International: 1-2 days
Blocking Peptide For anti-ETS2 (P100751_P050) antibody is Catalog # AAP31071 (Previous Catalog # AAPP01809)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human ETS2
Complete computational species homology data Anti-ETS2 (P100751_P050)
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express ETS2.
Swissprot Id P15036
Protein Name Protein C-ets-2

Yang, H; Schramek, D; Adam, RC; Keyes, BE; Wang, P; Zheng, D; Fuchs, E; ETS family transcriptional regulators drive chromatin dynamics and malignancy in squamous cell carcinomas. 4, e10870 (2015). IHC, WB, Cow, Dog, Human, Mouse, Rat, Sheep 26590320

Protein Accession # NP_005230
Purification Affinity Purified
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express ETS2.
Nucleotide Accession # NM_005239
Conjugation Options

P100751_P050-FITC Conjugated

P100751_P050-HRP Conjugated

P100751_P050-Biotin Conjugated

Species Reactivity Cow, Dog, Human, Mouse, Rat, Sheep
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 92%; Dog: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Sheep: 92%
Image 1
Human 293T
WB Suggested Antibody Titration: 0.2-1 ug/ml
Positive Control: Transfected 293T
Image 2
Human Breast

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

5754 Pacific Center Blvd., Suite 201 San Diego, CA 92121 USA | Tel: (858)552-6979 |