RBL1 Antibody - N-terminal region (P100682_P050)

• Product Number: P100682_P050
• Name: RBL1 Antibody - N-terminal region (P100682_P050)
• Protein Size (# AA): 1014 amino acids
• Molecular Weight: 115kDa
• NCBI Gene Id: 5933
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Retinoblastoma-like 1 (p107)
• Description:
  View product citations for RBL1 Antibody - N-terminal region (P100682_P050)on CiteAb
• Alias Symbols: PRB1, p107, CP107
• Peptide Sequence: Synthetic peptide located within the following region: FLDIFQNPYEEPPKLPRSRKQRRIPCSVKDLFNFCWTLFVYTKGNFRMIG
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Ross,A.S., (2008) Biochem. Biophys. Res. Commun. 366 (4), 927-931
• Description of Target: RBL1 is similar in sequence and possibly function to the product of the retinoblastoma 1 (RB1) gene. The RB1 gene product is a tumor suppressor protein that appears to be involved in cell cycle regulation, as it is phosphorylated in the S to M phase transition and is dephosphorylated in the G1 phase of the cell cycle. Both the RB1 protein and the product of this gene can form a complex with adenovirus E1A protein and SV40 large T-antigen, with the SV40 large T-antigen binding only to the unphosphorylated form of each protein. In addition, both proteins can inhibit the transcription of cell cycle genes containing E2F binding sites in their promoters. Due to the sequence and biochemical similarities with the RB1 protein, it is thought that the protein encoded by this gene may also be a tumor suppressor. The protein encoded by this gene is similar in sequence and possibly function to the product of the retinoblastoma 1 (RB1) gene. The RB1 gene product is a tumor suppressor protein that appears to be involved in cell cycle regulation, as it is phosphorylated in the S to M phase transition and is dephosphorylated in the G1 phase of the cell cycle. Both the RB1 protein and the product of this gene can form a complex with adenovirus E1A protein and SV40 large T-antigen, with the SV40 large T-antigen binding only to the unphosphorylated form of each protein. In addition, both proteins can inhibit the transcription of cell cycle genes containing E2F binding sites in their promoters. Due to the sequence and biochemical similarities with the RB1 protein, it is thought that the protein encoded by this gene may also be a tumor suppressor. Two transcript variants encoding different isoforms have been found for this gene.
• Protein Interactions: DYRK1B; DYRK1A; CDK2; MAGEA11; E2F1; AR; UBC; RBBP8; E2F4; PLSCR1; NUCB1; LAMB2; NR4A1; GOLGA2; FN1; EPHA2; CDK6; CDK4; AOX1; SP1; SNRPD3; DGKZ; ID2; RINT1; E2F3; E2F2; PPP1CA; TOP1; SMARCA4; CCNA2; LIN9; LIN54; LIN37; MYBL2; MAPK6; IRF3; RBL2; DHX30; NR2
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-RBL1 (P100682_P050) antibody is Catalog # AAP31024 (Previous Catalog # AAPP01757)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RBL1
• Uniprot ID: P28749-2
• Protein Name: Retinoblastoma-like protein 1
• Protein Accession #: NP_899662
• Purification: Affinity Purified
• Nucleotide Accession #: NM_183404
• Tested Species Reactivity: Human, Mouse
• Gene Symbol: RBL1
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 85%; Guinea Pig: 92%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 92%; Rat: 92%
• Image 1: Human COLO205
  
  WB Suggested Anti-RBL1 Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:62500
  Positive Control: COLO205 cell lysate
• Image 2: Mouse Pancreas
  
  Host: Mouse
  Target Name: RBL1
  Sample Tissue: Mouse Pancreas
  Antibody Dilution: 1ug/ml