TAL1 Antibody - C-terminal region (P100630_T100)

Data Sheet
 
Product Number P100630_T100
Product Page www.avivasysbio.com/tal1-antibody-c-terminal-region-p100630-t100.html
Name TAL1 Antibody - C-terminal region (P100630_T100)
Protein Size (# AA) 331 amino acids
Molecular Weight 34kDa
NCBI Gene Id 6886
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name T-cell acute lymphocytic leukemia 1
Description
Alias Symbols SCL, TCL5, tal-1, bHLHa17
Peptide Sequence Synthetic peptide located within the following region: QDVLSPNSSCGSSLDGAASPDSYTEEPAPKHTARSLHPAMLPAADGAGPR
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Le Clech,M., et al., (2006) J. Mol. Biol. 355 (1), 9-19
Description of Target The tal-1 proto-oncogene encodes a helix-loop-helix DNA-binding protein that has been implicated in the formation of T cell acute lymphoblastic leukemia (T-ALL).
Protein Interactions ELSPBP1; SIN3A; KAT2B; EP300; HOXB9; DRG1; CHD3; ZHX1; STUB1; UBC; RB1; SSBP2; SSBP3; RCOR1; KDM1A; LDB1; TCF12; TCF3; RBBP7; LYL1; HDAC2; HDAC1; CHD4; CBFA2T3; RUNX1; SUPT16H; TAL1; CDK9; TRIM33; SUV39H1; SATB1; TRIM27; NCAPG2; MAPK3; SP1; LMO1; LMO2; GA
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-TAL1 (P100630_T100) antibody
Blocking Peptide For anti-TAL1 (P100630_T100) antibody is Catalog # AAP30961 (Previous Catalog # AAPP01685)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human TAL1
Uniprot ID P17542
Protein Name T-cell acute lymphocytic leukemia protein 1
Publications

Akgül, B. et al. Garlic accelerates red blood cell turnover and splenic erythropoietic gene expression in mice: evidence for erythropoietin-independent erythropoiesis. PLoS One 5, e15358 (2010). 21206920

Protein Accession # NP_003180
Purification Protein A purified
Nucleotide Accession # NM_003189
Tested Species Reactivity Human
Gene Symbol TAL1
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 92%; Rabbit: 100%; Rat: 92%
Image 1
Human HepG2
WB Suggested Anti-TAL1 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2 cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com