SMAD3 Antibody - N-terminal region (P100621_T100)

Data Sheet
 
Product Number P100621_T100
Product Page www.avivasysbio.com/smad3-antibody-n-terminal-region-p100621-t100.html
Name SMAD3 Antibody - N-terminal region (P100621_T100)
Protein Size (# AA) 425 amino acids
Molecular Weight 48kDa
NCBI Gene Id 4088
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name SMAD family member 3
Description
Alias Symbols LDS3, LDS1C, MADH3, JV15-2, HSPC193, HsT17436
Peptide Sequence Synthetic peptide located within the following region: FTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELEKAIT
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Cheng,P.L., et al., (2004) Oncogene 23 (47), 7821-7838
Description of Target SMAD3 is a member of Smad family proteins. SMAD family is known to be important cytoplasmic mediators of signals from the transforming growth factor-beta (TGF-beta) receptor serine/threonine kinases.
Protein Interactions TEKT4; CCDC33; CPSF7; MEOX2; HDAC1; PHC2; WWP1; AES; BLZF1; UBC; TP53; SMAD4; BACH1; MAFK; FOXO3; NEDD8; TRIM33; WWP2; SMURF2; FOXM1; TRIM62; TP63; OTUB1; NEDD4L; BAG3; TGFB1I1; CSNK1D; RUNX1; HCVgp1; TSC2; FHL3; FHL2; FHL1; Melk; IRF7; RNF111; LCK; KLF5;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-SMAD3 (P100621_T100) antibody
Blocking Peptide For anti-SMAD3 (P100621_T100) antibody is Catalog # AAP30955 (Previous Catalog # AAPP01679)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human SMAD3
Uniprot ID P84022
Protein Accession # NP_005893
Purification Protein A purified
Nucleotide Accession # NM_005902
Tested Species Reactivity Human, Mouse
Gene Symbol SMAD3
Predicted Species Reactivity Human, Mouse, Rat, Dog, Guinea Pig, Zebrafish
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 100%
Image 1
Human Liver
WB Suggested Anti-SMAD3 Antibody Titration: 2.0ug/ml
Positive Control: Human Liver
Image 2
Human pancreas
Human Pancrease
Image 3
Mouse Testis
Host: Mouse
Target Name: SMAD3
Sample Tissue: Mouse Testis
Antibody Dilution: 1ug/ml
Image 4
Human Urinary Bladder
Rabbit Anti-SMAD3 Antibody
Catalog Number: P100621_T100
Formalin Fixed Paraffin Embedded Tissue: Human Urinary Bladder Tissue
Observed Staining: Cytoplasm
Primary Antibody Concentration: 1:100
Other Working Concentrations: N/A
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20X
Exposure Time: 0.5 - 2.0 sec
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com