Product Number |
P100591_T100 |
Product Page |
www.avivasysbio.com/nanog-antibody-n-terminal-region-p100591-t100.html |
Name |
NANOG Antibody - N-terminal region (P100591_T100) |
Protein Size (# AA) |
305 amino acids |
Molecular Weight |
35kDa |
NCBI Gene Id |
79923 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
Nanog homeobox |
Description |
|
Peptide Sequence |
Synthetic peptide located within the following region: PMPVICGPEENYPSLQMSSAEMPHTETVSPLPSSMDLLIQDSPDSSTSPK |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Piestun,D., et al., (2006) Biochem. Biophys. Res. Commun. 343 (1), 279-285 |
Description of Target |
NANOG is a new marker for testicular carcinoma in situ and germ cell tumors. Gene knockdown of Nanog promotes differentiation, thereby demonstrating a role for these factors in human embryonic stem cell self-renewal. |
Protein Interactions |
DOT1L; UBC; ZNF281; RHOXF2; SALL4; MED12; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-NANOG (P100591_T100) antibody |
Blocking Peptide |
For anti-NANOG (P100591_T100) antibody is Catalog # AAP30890 |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human NANOG |
Uniprot ID |
Q6JZS5 |
Protein Name |
Homeobox protein NANOG |
Protein Accession # |
NP_079141 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_024865 |
Tested Species Reactivity |
Human |
Gene Symbol |
NANOG |
Predicted Species Reactivity |
Human, Pig |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Human: 100%; Pig: 92% |
Image 1 | Human Jurkat
| WB Suggested Anti-NANOG Antibody Titration: 1.25 ug/ml Positive Control: Jurkat Whole Cell |
|
|