| Product Number |
P100591_P050 |
| Product Page |
www.avivasysbio.com/nanog-antibody-n-terminal-region-p100591-p050.html |
| Name |
NANOG Antibody - N-terminal region (P100591_P050) |
| Protein Size (# AA) |
305 amino acids |
| Molecular Weight |
35kDa |
| NCBI Gene Id |
79923 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Nanog homeobox |
| Description |
|
| Alias Symbols |
- |
| Peptide Sequence |
Synthetic peptide located within the following region: PMPVICGPEENYPSLQMSSAEMPHTETVSPLPSSMDLLIQDSPDSSTSPK |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Piestun,D., (2006) Biochem. Biophys. Res. Commun. 343 (1), 279-285 |
| Description of Target |
NANOG is a new marker for testicular carcinoma in situ and germ cell tumors. Gene knockdown of Nanog promotes differentiation, thereby demonstrating a role for these factors in human embryonic stem cell self-renewal. |
| Protein Interactions |
DOT1L; UBC; ZNF281; RHOXF2; SALL4; MED12; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-NANOG (P100591_P050) antibody |
| Blocking Peptide |
For anti-NANOG (P100591_P050) antibody is Catalog # AAP30890 (Previous Catalog # AAPS00101) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human NANOG |
| Uniprot ID |
Q6NSW7 |
| Protein Name |
Putative homeobox protein NANOGP8 |
| Publications |
Yang, C. et al. Opposing putative roles for canonical and noncanonical NFκB signaling on the survival, proliferation, and differentiation potential of human embryonic stem cells. Stem Cells 28, 1970-80 (2010). 20882529 |
| Protein Accession # |
NP_079141 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_024865 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
NANOG |
| Predicted Species Reactivity |
Human, Pig |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Human: 100%; Pig: 92% |
| Image 1 | Human Jurkat
 | WB Suggested Anti-NANOG Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Jurkat cell lysate |
|
|
