| Product Number |
AVARP20020_P050 |
| Product Page |
www.avivasysbio.com/serpinf1-antibody-n-terminal-region-avarp20020-p050.html |
| Name |
SERPINF1 Antibody - N-terminal region (AVARP20020_P050) |
| Protein Size (# AA) |
418 amino acids |
| Molecular Weight |
46kDa |
| NCBI Gene Id |
5176 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Serpin peptidase inhibitor, clade F (alpha-2 antiplasmin, pigment epithelium derived factor), member 1 |
| Alias Symbols |
OI6, OI12, PEDF, EPC-1, PIG35 |
| Peptide Sequence |
Synthetic peptide located within the following region: GALLGHSSCQNPASPPEEGSPDPDSTGALVEEEDPFFKVPVNKLAAAVSN |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Matsumoto,K., et al., (2004) Hepatology 40 (1), 252-259 |
| Description of Target |
The SERPINF1 gene may play a significant role in determining the balance of angiogenesis/ antiangiogenesis during atherogenesis. A novel role of extracellular phosphorylation is shown to completely change the nature of this gene from a neutrophic to an antiangiogenic factor. |
| Protein Interactions |
EPM2AIP1; LRP6; PNPLA2; MLH1; MYOC; NEDD4L; UBC; CSNK2A1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-SERPINF1 (AVARP20020_P050) antibody |
| Blocking Peptide |
For anti-SERPINF1 (AVARP20020_P050) antibody is Catalog # AAP30607 (Previous Catalog # AAPP01260) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human SERPINF1 |
| Uniprot ID |
P36955 |
| Protein Name |
Pigment epithelium-derived factor |
| Protein Accession # |
NP_002606 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_002615 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
SERPINF1 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Dog, Guinea Pig, Horse, Sheep |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Dog: 78%; Guinea Pig: 80%; Horse: 80%; Human: 100%; Mouse: 86%; Rat: 75%; Sheep: 86% |
| Image 1 | Human Placenta
 | WB Suggested Anti-SERPINF1 Antibody Titration: 0.2-1 ug/ml
Positive Control: Human Placenta |
|
| Image 2 | Human kidney
 | Human kidney |
|
