Product Number |
AVARP20005_P050 |
Product Page |
www.avivasysbio.com/tnfsf12-antibody-n-terminal-region-avarp20005-p050.html |
Name |
TNFSF12 Antibody - N-terminal region (AVARP20005_P050) |
Protein Size (# AA) |
249 amino acids |
Molecular Weight |
27kDa |
NCBI Gene Id |
8742 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Tumor necrosis factor (ligand) superfamily, member 12 |
Alias Symbols |
APO3L, DR3LG, TWEAK, TNLG4A |
Peptide Sequence |
Synthetic peptide located within the following region: QEELVAEEDQDPSELNPQTEESQDPAPFLNRLVRPRRSAPKGRKTRARRA |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Jin,L., et al., (2004) J. Invest. Dermatol. 122 (5), 1175-1179 |
Description of Target |
TNFSF12 is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This protein is a ligand for the FN14/TWEAKR receptor. This cytokine has overlapping signaling functions with TNF, but displays a much wider tissue distribution. This cytokine can induce apoptosis via multiple pathways of cell death in a cell type-specific manner. This cytokine is also found to promote proliferation and migration of endothelial cells, and thus acts as a regulator of angiogenesis. Two alternatively spliced transcript variants of this gene encoding distinct isoforms have been reported. |
Protein Interactions |
DDIT3; TNFSF13B; LYN; OTUB1; TRAF2; BIRC2; AGGF1; TNFRSF12A; TNFRSF25; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-TNFSF12 (AVARP20005_P050) antibody |
Blocking Peptide |
For anti-TNFSF12 (AVARP20005_P050) antibody is Catalog # AAP30630 (Previous Catalog # AAPP01283) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human TNFSF12 |
Uniprot ID |
O43508 |
Protein Name |
Tumor necrosis factor ligand superfamily member 12 |
Protein Accession # |
NP_003800 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_003809 |
Tested Species Reactivity |
Human |
Gene Symbol |
TNFSF12 |
Predicted Species Reactivity |
Human, Mouse, Horse |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Horse: 93%; Human: 100%; Mouse: 75% |
Image 1 | Human Muscle
| WB Suggested Anti-TNFSF12 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:12500 Positive Control: Human muscle |
|
|