TNFSF12 Antibody - N-terminal region (AVARP20005_P050)

Data Sheet
 
Product Number AVARP20005_P050
Product Page www.avivasysbio.com/tnfsf12-antibody-n-terminal-region-avarp20005-p050.html
Name TNFSF12 Antibody - N-terminal region (AVARP20005_P050)
Protein Size (# AA) 249 amino acids
Molecular Weight 27kDa
NCBI Gene Id 8742
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Tumor necrosis factor (ligand) superfamily, member 12
Alias Symbols APO3L, DR3LG, TWEAK, TNLG4A
Peptide Sequence Synthetic peptide located within the following region: QEELVAEEDQDPSELNPQTEESQDPAPFLNRLVRPRRSAPKGRKTRARRA
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Jin,L., et al., (2004) J. Invest. Dermatol. 122 (5), 1175-1179
Description of Target TNFSF12 is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This protein is a ligand for the FN14/TWEAKR receptor. This cytokine has overlapping signaling functions with TNF, but displays a much wider tissue distribution. This cytokine can induce apoptosis via multiple pathways of cell death in a cell type-specific manner. This cytokine is also found to promote proliferation and migration of endothelial cells, and thus acts as a regulator of angiogenesis. Two alternatively spliced transcript variants of this gene encoding distinct isoforms have been reported.
Protein Interactions DDIT3; TNFSF13B; LYN; OTUB1; TRAF2; BIRC2; AGGF1; TNFRSF12A; TNFRSF25;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-TNFSF12 (AVARP20005_P050) antibody
Blocking Peptide For anti-TNFSF12 (AVARP20005_P050) antibody is Catalog # AAP30630 (Previous Catalog # AAPP01283)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human TNFSF12
Uniprot ID O43508
Protein Name Tumor necrosis factor ligand superfamily member 12
Protein Accession # NP_003800
Purification Affinity Purified
Nucleotide Accession # NM_003809
Tested Species Reactivity Human
Gene Symbol TNFSF12
Predicted Species Reactivity Human, Mouse, Horse
Application WB
Predicted Homology Based on Immunogen Sequence Horse: 93%; Human: 100%; Mouse: 75%
Image 1
Human Muscle
WB Suggested Anti-TNFSF12 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: Human muscle
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com