KRT14 Antibody - C-terminal region (AVARP15002_T100)

Data Sheet
 
Product Number AVARP15002_T100
Product Page www.avivasysbio.com/krt14-antibody-c-terminal-region-avarp15002-t100.html
Name KRT14 Antibody - C-terminal region (AVARP15002_T100)
Protein Size (# AA) 472 amino acids
Molecular Weight 52kDa
NCBI Gene Id 3861
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Keratin 14
Alias Symbols K14, NFJ, CK14, EBS3, EBS4
Peptide Sequence Synthetic peptide located within the following region: DAHLSSSQFSSGSQSSRDVTSSSRQIRTKVMDVHDGKVVSTHEQVLRTKN
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Pfendner,E.G., et al., (2005) J. Invest. Dermatol. 125 (2), 239-243
Description of Target KRT14 is a type I keratin, which is usually found as a heterotetramer with two keratin 5 molecules, a type II keratin. Together they form the cytoskeleton of epithelial cells.
Protein Interactions UBC; Iqcb1; Nphp4; Cep290; Nphp1; Invs; HSPA5; ALB; EIF4A3; MAGOH; KRT5; KRT3; HNRNPU; HNRNPC; EVPL; UBASH3B; SHC1; PIK3R2; INPPL1; GRB2; EPS15; CRK; AP2M1; CBL; MDM2; CAND1; COPS5; CUL1; CUL2; CUL3; CUL4B; CUL5; NEDD8; SUMO1; SUMO2; SUMO3; PTEN; POU5F1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-KRT14 (AVARP15002_T100) antibody
Blocking Peptide For anti-KRT14 (AVARP15002_T100) antibody is Catalog # AAP30449 (Previous Catalog # AAPP01033)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human KRT14
Uniprot ID P02533
Protein Name Keratin, type I cytoskeletal 14
Protein Accession # NP_000517
Purification Protein A purified
Nucleotide Accession # NM_000526
Tested Species Reactivity Human, Mouse
Gene Symbol KRT14
Predicted Species Reactivity Mouse, Rat, Guinea Pig, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Guinea Pig: 85%; Mouse: 85%; Rabbit: 92%; Rat: 100%
Image 1
Human Thymus
WB Suggested Anti-KRT14 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:312500
Positive Control: Human Thymus
Image 2
Mouse Testis
Host: Mouse
Target Name: KRT14
Sample Tissue: Mouse Testis
Antibody Dilution: 1ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com