| Product Number |
AVARP13104_T100 |
| Product Page |
www.avivasysbio.com/trhr-antibody-middle-region-avarp13104-t100.html |
| Name |
TRHR Antibody - middle region (AVARP13104_T100) |
| Protein Size (# AA) |
398 amino acids |
| Molecular Weight |
45kDa |
| NCBI Gene Id |
7201 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Thyrotropin-releasing hormone receptor |
| Alias Symbols |
CHNG7, TRH-R |
| Peptide Sequence |
Synthetic peptide located within the following region: ISCGYKISRNYYSPIYLMDFGVFYVVPMILATVLYGFIARILFLNPIPSD |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Iwasaki, T., et al., (1996). J. Biol. Chem. 271 (36), 22183-22188. |
| Description of Target |
TRHR is a receptor for thyrotropin-releasing hormone. This receptor is mediated by G proteins which activate a phosphatidylinositol-calcium second messenger system. |
| Protein Interactions |
TRHR; TRH; ARRB1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-TRHR (AVARP13104_T100) antibody |
| Blocking Peptide |
For anti-TRHR (AVARP13104_T100) antibody is Catalog # AAP30770 (Previous Catalog # AAPP01433) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human TRHR |
| Uniprot ID |
P34981 |
| Protein Name |
Thyrotropin-releasing hormone receptor |
| Protein Accession # |
NP_003292 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_003301 |
| Gene Symbol |
TRHR |
| Predicted Species Reactivity |
Mouse, Rat, Dog, Pig, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Dog: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100% |
| Image 1 | Human Jurkat Whole Cell
 | Host: Rabbit
Target Name: TRHR
Sample Tissue: Human Jurkat Whole Cell
Antibody Dilution: 1ug/ml |
|
|
