website statistics
Product Datasheet: AVARP13084_P050 - CHRNA1 antibody - C-terminal region (AVARP13084_P050) - Aviva Systems Biology
 
CHRNA1 antibody - C-terminal region (AVARP13084_P050)
Data Sheet
 
Product Number AVARP13084_P050
Product Page www.avivasysbio.com/chrna1-antibody-c-terminal-region-avarp13084-p050.html
Product Name CHRNA1 antibody - C-terminal region (AVARP13084_P050)
Size 100 ul
Gene Symbol CHRNA1
Alias Symbols ACHRA, ACHRD, CHRNA, CMS2A, FCCMS, SCCMS
Protein Size (# AA) 457 amino acids
Molecular Weight 52kDa
Subunit alpha
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
NCBI Gene Id 1134
Host Rabbit
Clonality Polyclonal
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Official Gene Full Name Cholinergic receptor, nicotinic, alpha 1 (muscle)
Description This is a rabbit polyclonal antibody against CHRNA1. It was validated on Western Blot and immunohistochemistry by Aviva Systems Biology. At Aviva Systems Biology we manufacture rabbit polyclonal antibodies on a large scale (200-1000 products/month) of high throughput manner. Our antibodies are peptide based and protein family oriented. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (info@avivasysbio.com).
Peptide Sequence Synthetic peptide located within the following region: STHVMPNWVRKVFIDTIPNIMFFSTMKRPSREKQDKKIFTEDIDISDISG
Target Reference Webster,R., et al., (2004) Neurology 62 (7), 1090-1096
Description of Target CHRNA1 encodes an alpha subunit that plays a role in acetlycholine binding/channel gating. The muscle acetylcholine receptor consiststs of 5 subunits of 4 different types: 2 alpha isoforms and 1 each of beta, gamma, and delta subunits.
Protein Interactions ITGA7; CHRND; CHRNG; CHRNE;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Lead Time Domestic: within 1-2 days delivery International: 1-2 days
Blocking Peptide For anti-CHRNA1 (AVARP13084_P050) antibody is Catalog # AAP30746 (Previous Catalog # AAPP01407)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human CHRNA1
Complete computational species homology data Anti-CHRNA1 (AVARP13084_P050)
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express CHRNA1.
Swissprot Id P02708-2
Protein Name Acetylcholine receptor subunit alpha
Protein Accession # NP_000070
Purification Affinity Purified
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express CHRNA1.
Nucleotide Accession # NM_000079
Replacement Item This antibody may replace item sc-136130 from Santa Cruz Biotechnology.
Conjugation Options

AVARP13084_P050-FITC Conjugated

AVARP13084_P050-HRP Conjugated

AVARP13084_P050-Biotin Conjugated

CB Replacement sc-136130; sc-1442; sc-158225; sc-292790; sc-32252; sc-32253; sc-42524; sc-42525; sc-58602; sc-58603; sc-58604; sc-65824; sc-65836; sc-65838
Species Reactivity Dog, Guinea Pig, Human, Mouse, Pig, Rabbit
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Dog: 100%; Guinea Pig: 86%; Human: 100%; Mouse: 80%; Pig: 100%; Rabbit: 93%
Image 1
Human Intestine
Human Intestine
Image 2
Human Fetal Lung

Host: Rabbit
Target Name: CHRNA1
Sample Tissue: Human Fetal Lung
Antibody Dilution: 1.0ug/ml

 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
5754 Pacific Center Blvd., Suite 201 San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com