| Product Number |
AVARP13054_T100 |
| Product Page |
www.avivasysbio.com/pmch-antibody-n-terminal-region-avarp13054-t100.html |
| Name |
PMCH Antibody - N-terminal region (AVARP13054_T100) |
| Protein Size (# AA) |
165 amino acids |
| Molecular Weight |
19kDa |
| NCBI Gene Id |
5367 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Pro-melanin-concentrating hormone |
| Alias Symbols |
MCH, ppMCH |
| Peptide Sequence |
Synthetic peptide located within the following region: RLGKGFQKEDTAEKSVIAPSLEQYKNDESSFMNEEENKVSKNTGSKHNFL |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Presse, F., et al., (1990) Mol. Endocrinol. 4:632-637. |
| Description of Target |
MCH may act as a neurotransmitter or neuromodulator in a broad array of neuronal functions directed toward the regulation of goal-directed behavior, such as food intake, and general arousal. May also have a role in spermatocyte differentiation. |
| Protein Interactions |
MCHR2; MCHR1; PCSK5; PCSK7; PCSK6; NPY; PCSK2; PCSK1; FURIN; CPE; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for AVARP13054_T100 |
| Blocking Peptide |
Catalog # AAP30733 (Previous Catalog # AAPP01390) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human PMCH |
| Uniprot ID |
P20382 |
| Protein Name |
Pro-MCH |
| Protein Accession # |
NP_002665 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_002674 |
| Gene Symbol |
PMCH |
| Predicted Species Reactivity |
Mouse, Rat, Cow, Pig |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 92%; Mouse: 78%; Pig: 85%; Rat: 78% |
| Image 1 | |
|
