NAPA Antibody - N-terminal region (AVARP13049_T100)

Data Sheet
 
Product Number AVARP13049_T100
Product Page www.avivasysbio.com/napa-antibody-n-terminal-region-avarp13049-t100.html
Name NAPA Antibody - N-terminal region (AVARP13049_T100)
Protein Size (# AA) 295 amino acids
Molecular Weight 33kDa
NCBI Gene Id 8775
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name N-ethylmaleimide-sensitive factor attachment protein, alpha
Alias Symbols SNAPA
Peptide Sequence Synthetic peptide located within the following region: MDNSGKEAEAMALLAEAERKVKNSQSFFSGLFGGSSKIEEACEIYARAAN
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Lemons, P.P., et al., (1997) Blood 90 (4), 1490-1500.
Description of Target The 'SNARE hypothesis' is a model explaining the process of docking and fusion of vesicles to their target membranes. According to this model, membrane proteins from the vesicle (v-SNAREs) and proteins from the target membrane (t-SNAREs) govern the specificity of vesicle targeting and docking through mutual recognition. Once the 2 classes of SNAREs bind to each other, they form a complex that recruits the general elements of the fusion apparatus, namely NSF (N-ethylmaleimide-sensitive factor) and SNAPs (soluble NSF-attachment proteins), to the site of membrane fusion, thereby forming the 20S fusion complex. Alpha- and gamma-SNAP are found in a wide range of tissues and act synergistically in intra-Golgi transport. The sequence of the predicted 295-amino acid human protein encoded by NAPA shares 37%, 60%, and 67% identity with the sequences of yeast, Drosophila, and squid alpha-SNAP, respectively.
Protein Interactions UBC; RPA3; RPA2; RPA1; RNF2; ATP4A; STX5; ITGA4; FN1; VCAM1; VCP; DHX40; DHX29; THUMPD3; STAM2; VAMP2; APP; NSF; TRPC3; RTN4; STX12; GNA12; STX8; GOSR2; GOSR1; BNIP1; STX7; VAMP8; SNAP23; STX4; STX1A; SNAP25;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-NAPA (AVARP13049_T100) antibody
Blocking Peptide For anti-NAPA (AVARP13049_T100) antibody is Catalog # AAP30724 (Previous Catalog # AAPP01381)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human NAPA
Uniprot ID P54920
Protein Name Alpha-soluble NSF attachment protein
Protein Accession # NP_003818
Purification Protein A purified
Nucleotide Accession # NM_003827
Gene Symbol NAPA
Predicted Species Reactivity Mouse, Cow, Dog, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Mouse: 78%; Zebrafish: 78%
Image 1

 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com