HTR7 Antibody - N-terminal region (AVARP13048_P050)

• Product Number: AVARP13048_P050
• Name: HTR7 Antibody - N-terminal region (AVARP13048_P050)
• Protein Size (# AA): 479 amino acids
• Molecular Weight: 54kDa
• NCBI Gene Id: 3363
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: 5-hydroxytryptamine (serotonin) receptor 7, adenylate cyclase-coupled
• Alias Symbols: 5-HT7
• Peptide Sequence: Synthetic peptide located within the following region: HLLSEVTASPAPTWDAPPDNASGCGEQINYGRVEKVVIGSILTLITLLTI
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Ikeda,M., et al., (2006) Neuropsychopharmacology 31 (4), 866-871
• Description of Target: This is one of the several different receptors for 5- hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. The activity of this receptor is mediated by g proteins that stimulate adenylate cyclase.
• Protein Interactions: GPRASP2; GPRASP1; RHOBTB3; CUL3;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-HTR7 (AVARP13048_P050) antibody is Catalog # AAP30722
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human HTR7
• Uniprot ID: P34969
• Protein Name: 5-hydroxytryptamine receptor 7
• Protein Accession #: NP_062873
• Purification: Affinity Purified
• Nucleotide Accession #: NM_019859
• Tested Species Reactivity: Human
• Gene Symbol: HTR7
• Predicted Species Reactivity: Human, Mouse, Rat, Dog, Horse, Pig
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Dog: 100%; Horse: 85%; Human: 100%; Mouse: 92%; Pig: 85%; Rat: 92%
• Image 1: Human Jurkat
  
  WB Suggested Anti-HTR7 Antibody Titration: 0.125ug/ml
  ELISA Titer: 1:1562500
  Positive Control: Jurkat cell lysate