HTR3A Antibody - N-terminal region (AVARP13046_P050)

• Product Number: AVARP13046_P050
• Name: HTR3A Antibody - N-terminal region (AVARP13046_P050)
• Protein Size (# AA): 478 amino acids
• Molecular Weight: 55 kDa
• NCBI Gene Id: 3359
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: 5-hydroxytryptamine (serotonin) receptor 3A, ionotropic
• Alias Symbols: HTR3, 5HT3R, 5-HT-3, 5-HT3A, 5-HT3R
• Peptide Sequence: Synthetic peptide located within the following region: LLLPTLLAQGEARRSRNTTRPALLRLSDYLLTNYRKGVRPVRDWRKPTTV
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Panicker,S., et al., (2004) J. Biol. Chem. 279 (27), 28149-28158
• Description of Target: HTR3A belongs to the ligand-gated ion channel receptor superfamily. It is the subunit A of the type 3 receptor for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. This receptor causes fast, depolarizing responses in neurons after activation. It appears that the heteromeric combination of A and B subunits is necessary to provide the full functional features of this receptor, since either subunit alone results in receptors with very low conductance and response amplitude. Alternatively spliced transcript variants encoding different isoforms have been identified.
• Protein Interactions: HSPA5; CANX;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Enhanced Validation:

  WB	Y
  SPR
  YCHAROS

• Blocking Peptide: For anti-HTR3A (AVARP13046_P050) antibody is Catalog # AAP30718 (Previous Catalog # AAPP01375)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human HTR3A
• Uniprot ID: P46098
• Protein Name: 5-hydroxytryptamine receptor 3A
• Publications:

  Rinaldi, A. et al. Serotonin receptor 3A expression in normal and neoplastic B cells. Pathobiology 77, 129-35 (2010). 20516728

• Protein Accession #: NP_000860
• Nucleotide Accession #: NM_000869
• Tested Species Reactivity: Human
• Gene Symbol: HTR3A
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Horse
• Application: IHC, WB
• Predicted Homology Based on Immunogen Sequence: Cow: 78%; Dog: 78%; Horse: 91%; Human: 100%; Mouse: 78%; Rat: 78%
• Image 1: Human kidney
  
  Human kidney
• Image 2: Human Jurkat
  
  WB Suggested Anti-HTR3A Antibody Titration: 0.2-1 ug/ml
  Positive Control: Jurkat cell lysate
• Image 3: Human 721_B Whole Cell
  
  Host: Rabbit
  Target Name: 5HT3A
  Sample Type: 721_B Whole Cell lysates
  Antibody Dilution: 5ug/ml
• Image 4: Human RPMI-8226
  
  Host: Rabbit
  Target Name: 5HT3A
  Sample Type: RPMI-8226 lysates
  Antibody Dilution: 1.0ug/ml