| Product Number |
AVARP13042_T100 |
| Product Page |
www.avivasysbio.com/htr1b-antibody-n-terminal-region-avarp13042-t100.html |
| Name |
HTR1B Antibody - N-terminal region (AVARP13042_T100) |
| Protein Size (# AA) |
390 amino acids |
| Molecular Weight |
44kDa |
| NCBI Gene Id |
3351 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
5-hydroxytryptamine (serotonin) receptor 1B, G protein-coupled |
| Alias Symbols |
S12, 5-HT1B, HTR1D2, HTR1DB, 5-HT-1B, 5-HT1DB, 5-HT-1D-beta |
| Peptide Sequence |
Synthetic peptide located within the following region: MEEPGAQCAPPPPAGSETWVPQANLSSAPSQNCSAKDYIYQDSISLPWKV |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
L, et al., (2004) Biol. Psychiatry 55 (3), 225-233 |
| Description of Target |
The pathophysiology of depression remains enigmatic, although abnormalities that involve serotonin signaling have been implicated. The serotonin 1B receptor [5-hydroxytryptamine (5-HT1B) receptor] interacts with p11. p11 increases localization of 5-HT1B receptors at the cell surface. p11 is increased in rodent brains by antidepressants or electroconvulsive therapy, but decreased in an animal model of depression and in brain tissue from depressed patients. Overexpression of p11 increases 5-HT1B receptor function in cells and recapitulates certain behaviors seen after antidepressant treatment in mice. p11 knockout mice exhibit a depression-like phenotype and have reduced responsiveness to 5-HT1B receptor agonists and reduced behavioral reactions to an antidepressant. |
| Protein Interactions |
MDFI; HTR1D; HTR1B; HTR1A; GSTK1; NME2; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-HTR1B (AVARP13042_T100) antibody |
| Blocking Peptide |
For anti-HTR1B (AVARP13042_T100) antibody is Catalog # AAP30711 (Previous Catalog # AAPP01368) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human HTR1B |
| Uniprot ID |
P28222 |
| Protein Name |
5-hydroxytryptamine receptor 1B |
| Protein Accession # |
NP_000854 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_000863 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
HTR1B |
| Predicted Species Reactivity |
Human |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Human: 100% |
| Image 1 | Human HepG2
 | WB Suggested Anti-HTR1B Antibody Titration: 1.25ug/ml
Positive Control: HepG2 cell lysate |
|
|
