Product Number |
AVARP13041_T100 |
Product Page |
www.avivasysbio.com/htr1a-antibody-n-terminal-region-avarp13041-t100.html |
Name |
HTR1A Antibody - N-terminal region (AVARP13041_T100) |
Protein Size (# AA) |
422 amino acids |
Molecular Weight |
46kDa |
NCBI Gene Id |
3350 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
5-hydroxytryptamine (serotonin) receptor 1A, G protein-coupled |
Alias Symbols |
G-21, 5HT1a, PFMCD, 5-HT1A, 5-HT-1A, ADRBRL1, ADRB2RL1 |
Peptide Sequence |
Synthetic peptide located within the following region: GQGNNTTSPPAPFETGGNTTGISDVTVSYQVITSLLLGTLIFCAVLGNAC |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Lopez-Figueroa,A.L., et al., (2004) Biol. Psychiatry 55 (3), 225-233. |
Description of Target |
This is one of the several different receptors for 5- hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. The activity of this receptor is mediated by G proteins that inhibits adenylate cyclase activity. |
Protein Interactions |
UBC; RHOA; GABBR2; GPR26; S1PR1; S1PR3; HTR1D; HTR1B; GNAI3; HTR1A; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-HTR1A (AVARP13041_T100) antibody |
Blocking Peptide |
For anti-HTR1A (AVARP13041_T100) antibody is Catalog # AAP30710 (Previous Catalog # AAPP01367) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human HTR1A |
Uniprot ID |
P08908 |
Protein Name |
5-hydroxytryptamine receptor 1A |
Protein Accession # |
NP_000515 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_000524 |
Tested Species Reactivity |
Human |
Gene Symbol |
HTR1A |
Predicted Species Reactivity |
Human |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Human: 100% |
Image 1 | Human Jurkat
| WB Suggested Anti-HTR1A Antibody Titration: 0.0625ug/ml ELISA Titer: 1:62500 Positive Control: Jurkat cell lysate |
|
|