HTR1A Antibody - N-terminal region (AVARP13041_P050)

• Product Number: AVARP13041_P050
• Name: HTR1A Antibody - N-terminal region (AVARP13041_P050)
• Protein Size (# AA): 422 amino acids
• Molecular Weight: 46kDa
• NCBI Gene Id: 3350
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: 5-hydroxytryptamine (serotonin) receptor 1A, G protein-coupled
• Description:
  View product citations for HTR1A Antibody - N-terminal region (AVARP13041_P050) on CiteAb
• Alias Symbols: G-21, 5HT1a, PFMCD, 5-HT1A, 5-HT-1A, ADRBRL1, ADRB2RL1
• Peptide Sequence: Synthetic peptide located within the following region: GQGNNTTSPPAPFETGGNTTGISDVTVSYQVITSLLLGTLIFCAVLGNAC
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Czesak,M., (2006) J. Neurosci. 26 (6), 1864-1871
• Description of Target: This is one of the several different receptors for 5- hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. The activity of this receptor is mediated by G proteins that inhibits adenylate cyclase activity.
• Protein Interactions: UBC; RHOA; GABBR2; GPR26; S1PR1; S1PR3; HTR1D; HTR1B; GNAI3; HTR1A;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-HTR1A (AVARP13041_P050) antibody is Catalog # AAP30710
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human HTR1A
• Uniprot ID: P08908
• Protein Name: 5-hydroxytryptamine receptor 1A
• Publications:

  Adeosun, S. O., Albert, P. R., Austin, M. C. & Iyo, A. H. 17beta-estradiol-induced regulation of the novel 5-HT1A-related transcription factors NUDR and Freud-1 in SH SY5Y cells. Cell. Mol. Neurobiol. 32, 517-21 (2012). 22328058

  Cordeaux, Y., Pasupathy, D., Bacon, J., Charnock-Jones, D. S. & Smith, G. C. S. Characterization of serotonin receptors in pregnant human myometrium. J. Pharmacol. Exp. Ther. 328, 682-91 (2009). 19075042

  Iyo, A. H. et al. Differential regulation of the serotonin 1 A transcriptional modulators five prime repressor element under dual repression-1 and nuclear-deformed epidermal autoregulatory factor by chronic stress. Neuroscience 163, 1119-27 (2009). 19647046

  Szewczyk, B. et al. Decreased expression of Freud-1/CC2D1A, a transcriptional repressor of the 5-HT1A receptor, in the prefrontal cortex of subjects with major depression. Int. J. Neuropsychopharmacol. 13, 1089-101 (2010). 20392296

  Szewczyk, B. et al. Gender-specific decrease in NUDR and 5-HT1A receptor proteins in the prefrontal cortex of subjects with major depressive disorder. Int. J. Neuropsychopharmacol. 12, 155-68 (2009). 18561871

• Protein Accession #: NP_000515
• Purification: Affinity Purified
• Nucleotide Accession #: NM_000524
• Tested Species Reactivity: Human
• Gene Symbol: HTR1A
• Predicted Species Reactivity: Human
• Application: WB, IF
• Predicted Homology Based on Immunogen Sequence: Human: 100%
• Image 1: Human myometrial
  
  HTR1A antibody - N-terminal region (AVARP13041_P050) validated by WB using primary cultured neurons
• Image 2: Human Jurkat
  
  Host: Rabbit
  Target Name: HTR1A
  Sample Type: Jurkat Whole Cell lysates
  Antibody Dilution: 1.0ug/ml
• Image 3: Jurkat
  
  Host: Rabbit
  Target Name: HTR1A
  Sample Type: Jurkat
  Lane A: Primary Antibody
  Lane B: Primary Antibody + Blocking Peptide
  Primary Antibody Concentration: 1.0ug/mL
  Peptide Concentration: 1.0ug/mL
  Lysate Quantity: 25ug/lane
  Gel Concentration: 12%
• Image 4: Primary cultured neurons 5HT1A Receptors
  
  Primary cultured neurons 5HT1A Receptors Dilution:
  Primary: 1:200
  Secondary: 1:2000