GDI2 Antibody - C-terminal region (AVARP13037_P050)

Data Sheet
 
Product Number AVARP13037_P050
Product Page www.avivasysbio.com/gdi2-antibody-c-terminal-region-avarp13037-p050.html
Name GDI2 Antibody - C-terminal region (AVARP13037_P050)
Protein Size (# AA) 445 amino acids
Molecular Weight 51kDa
NCBI Gene Id 2665
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name GDP dissociation inhibitor 2
Alias Symbols RABGDIB, HEL-S-46e
Peptide Sequence Synthetic peptide located within the following region: EPEKEIRPALELLEPIEQKFVSISDLLVPKDLGTESQIFISRTYDATTHF
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Bruneel,A., et al., (2005) Proteomics 5 (15), 3876-3884
Description of Target GDP dissociation inhibitors are proteins that regulate the GDP-GTP exchange reaction of members of the rab family, small GTP-binding proteins of the ras superfamily, that are involved in vesicular trafficking of molecules between cellular organelles. GDIs slow the rate of dissociation of GDP from rab proteins and release GDP from membrane-bound rabs. The GDI2 gene contains many repetitive elements indicating that it may be prone to inversion/deletion rearrangements.GDP dissociation inhibitors are proteins that regulate the GDP-GTP exchange reaction of members of the rab family, small GTP-binding proteins of the ras superfamily, that are involved in vesicular trafficking of molecules between cellular organelles. GDIs slow the rate of dissociation of GDP from rab proteins and release GDP from membrane-bound rabs. GDI2 is ubiquitously expressed. The GDI2 gene contains many repetitive elements indicating that it may be prone to inversion/deletion rearrangements.
Protein Interactions HUWE1; UBC; SUMO2; DUT; BAG3; IQCB1; GLRA2; FN1; SMURF1; RAB1A; RAB11B; AIP; ISG15; SIRT7; ELAVL1; Rab5c; Cdk1; Mapk13; RAB24; RAB11A; RAB9A; RAB5A; RAB4A; RAB2A; RAB8A;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-GDI2 (AVARP13037_P050) antibody
Blocking Peptide For anti-GDI2 (AVARP13037_P050) antibody is Catalog # AAP30700 (Previous Catalog # AAPP01357)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human GDI2
Uniprot ID P50395
Protein Name Rab GDP dissociation inhibitor beta
Sample Type Confirmation

GDI2 is strongly supported by BioGPS gene expression data to be expressed in HepG2

Protein Accession # NP_001485
Purification Affinity Purified
Nucleotide Accession # NM_001494
Tested Species Reactivity Human
Gene Symbol GDI2
Predicted Species Reactivity Human, Mouse, Guinea Pig, Horse, Sheep
Application WB
Predicted Homology Based on Immunogen Sequence Guinea Pig: 92%; Horse: 100%; Human: 100%; Mouse: 92%; Sheep: 100%
Image 1
Human Fetal Lung
Host: Rabbit
Target Name: GDI2
Sample Tissue: Human Fetal Lung
Antibody Dilution: 1.0ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com