Product Number |
AVARP13037_P050 |
Product Page |
www.avivasysbio.com/gdi2-antibody-c-terminal-region-avarp13037-p050.html |
Name |
GDI2 Antibody - C-terminal region (AVARP13037_P050) |
Protein Size (# AA) |
445 amino acids |
Molecular Weight |
51kDa |
NCBI Gene Id |
2665 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
GDP dissociation inhibitor 2 |
Alias Symbols |
RABGDIB, HEL-S-46e |
Peptide Sequence |
Synthetic peptide located within the following region: EPEKEIRPALELLEPIEQKFVSISDLLVPKDLGTESQIFISRTYDATTHF |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Bruneel,A., et al., (2005) Proteomics 5 (15), 3876-3884 |
Description of Target |
GDP dissociation inhibitors are proteins that regulate the GDP-GTP exchange reaction of members of the rab family, small GTP-binding proteins of the ras superfamily, that are involved in vesicular trafficking of molecules between cellular organelles. GDIs slow the rate of dissociation of GDP from rab proteins and release GDP from membrane-bound rabs. The GDI2 gene contains many repetitive elements indicating that it may be prone to inversion/deletion rearrangements.GDP dissociation inhibitors are proteins that regulate the GDP-GTP exchange reaction of members of the rab family, small GTP-binding proteins of the ras superfamily, that are involved in vesicular trafficking of molecules between cellular organelles. GDIs slow the rate of dissociation of GDP from rab proteins and release GDP from membrane-bound rabs. GDI2 is ubiquitously expressed. The GDI2 gene contains many repetitive elements indicating that it may be prone to inversion/deletion rearrangements. |
Protein Interactions |
HUWE1; UBC; SUMO2; DUT; BAG3; IQCB1; GLRA2; FN1; SMURF1; RAB1A; RAB11B; AIP; ISG15; SIRT7; ELAVL1; Rab5c; Cdk1; Mapk13; RAB24; RAB11A; RAB9A; RAB5A; RAB4A; RAB2A; RAB8A; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-GDI2 (AVARP13037_P050) antibody |
Blocking Peptide |
For anti-GDI2 (AVARP13037_P050) antibody is Catalog # AAP30700 (Previous Catalog # AAPP01357) |
Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human GDI2 |
Uniprot ID |
P50395 |
Protein Name |
Rab GDP dissociation inhibitor beta |
Sample Type Confirmation |
GDI2 is strongly supported by BioGPS gene expression data to be expressed in HepG2 |
Protein Accession # |
NP_001485 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_001494 |
Tested Species Reactivity |
Human |
Gene Symbol |
GDI2 |
Predicted Species Reactivity |
Human, Mouse, Guinea Pig, Horse, Sheep |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Guinea Pig: 92%; Horse: 100%; Human: 100%; Mouse: 92%; Sheep: 100% |
Image 1 | Human Fetal Lung
| Host: Rabbit Target Name: GDI2 Sample Tissue: Human Fetal Lung Antibody Dilution: 1.0ug/ml |
|