| Product Number |
AVARP13034_T100 |
| Product Page |
www.avivasysbio.com/gabrp-antibody-n-terminal-region-avarp13034-t100.html |
| Name |
GABRP Antibody - N-terminal region (AVARP13034_T100) |
| Protein Size (# AA) |
440 amino acids |
| Molecular Weight |
51 kDa |
| Subunit |
pi |
| NCBI Gene Id |
2568 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Gamma-aminobutyric acid (GABA) A receptor, pi |
| Peptide Sequence |
Synthetic peptide located within the following region: VEVGRSDKLSLPGFENLTAGYNKFLRPNFGGEPVQIALTLDIASISSISE |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Neelands,T.R., et al., (1999) Mol. Pharmacol. 56 (3), 598-610 |
| Description of Target |
The gamma-aminobutyric acid (GABA) A receptor is a multisubunit chloride channel that mediates the fastest inhibitory synaptic transmission in the central nervous system. The subunit encoded by this gene is expressed in several non-neuronal tissues including the uterus and ovaries. This subunit can assemble with known GABA A receptor subunits, and the presence of this subunit alters the sensitivity of recombinant receptors to modulatory agents such as pregnanolone. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-GABRP (AVARP13034_T100) antibody |
| Blocking Peptide |
For anti-GABRP (AVARP13034_T100) antibody is Catalog # AAP30695 |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human GABRP |
| Uniprot ID |
O00591 |
| Protein Name |
Gamma-aminobutyric acid receptor subunit pi |
| Protein Accession # |
NP_055026 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_014211 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
GABRP |
| Predicted Species Reactivity |
Human, Mouse, Rat, Dog, Horse, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100% |
| Image 1 | Human esophagus, Human stomach
 | Host: Rabbit
Target: GABRP
Positive control (+): Human esophagus (ES)
Negative control (-): Human stomach (ST)
Antibody concentration: 1ug/ml |
|
| Image 2 | Human 293T
 | Host: Rabbit
Target Name: GABRP
Sample Tissue: Human 293T
Antibody Dilution: 1.0ug/ml |
|
| Image 3 | Human HepG2 Whole Cell
 | Host: Rabbit
Target Name: GABRP
Sample Tissue: Human HepG2 Whole Cell
Antibody Dilution: 1ug/ml |
|
| Image 4 | Western Blot
 | 25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment. |
|
