Product Number |
AVARP13034_P050 |
Product Page |
www.avivasysbio.com/gabrp-antibody-n-terminal-region-avarp13034-p050.html |
Name |
GABRP Antibody - N-terminal region (AVARP13034_P050) |
Protein Size (# AA) |
440 amino acids |
Molecular Weight |
51 kDa |
Subunit |
pi |
NCBI Gene Id |
2568 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Gamma-aminobutyric acid (GABA) A receptor, pi |
Description |
|
Alias Symbols |
MGC126386, MGC126387 |
Peptide Sequence |
Synthetic peptide located within the following region: VEVGRSDKLSLPGFENLTAGYNKFLRPNFGGEPVQIALTLDIASISSISE |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Neelands,T.R. et al., (1999) Mol. Pharmacol. 56 (3), 598-610 |
Description of Target |
The gamma-aminobutyric acid (GABA) A receptor is a multisubunit chloride channel that mediates the fastest inhibitory synaptic transmission in the central nervous system. The subunit encoded GABRP is expressed in several non-neuronal tissues including the uterus and ovaries. This subunit can assemble with known GABA A receptor subunits, and the presence of this subunit alters the sensitivity of recombinant receptors to modulatory agents such as pregnanolone.The gamma-aminobutyric acid (GABA) A receptor is a multisubunit chloride channel that mediates the fastest inhibitory synaptic transmission in the central nervous system. The subunit encoded by this gene is expressed in several non-neuronal tissues including the uterus and ovaries. This subunit can assemble with known GABA A receptor subunits, and the presence of this subunit alters the sensitivity of recombinant receptors to modulatory agents such as pregnanolone. |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Enhanced Validation |
Relative Expression (Western Blot) |
|
|
Datasheets/Manuals |
Printable datasheet for anti-GABRP (AVARP13034_P050) antibody |
Blocking Peptide |
For anti-GABRP (AVARP13034_P050) antibody is Catalog # AAP30695 (Previous Catalog # AAPP01352) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human GABRP |
Uniprot ID |
O00591 |
Protein Name |
Gamma-aminobutyric acid receptor subunit pi |
Publications |
Use of a human embryonic stem cell model to discover GABRP, WFDC2, VTCN1 and ACTC1 as markers of early first trimester human trophoblast. Mol Hum Reprod. 26, 425-440 (2020) 32359161 |
Protein Accession # |
NP_055026 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_014211 |
Tested Species Reactivity |
Human |
Gene Symbol |
GABRP |
Predicted Species Reactivity |
Human, Mouse, Rat, Dog, Horse, Rabbit |
Application |
IHC, WB |
Predicted Homology Based on Immunogen Sequence |
Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100% |
Image 1 | Human HepG2 Whole Cell
| Host: Rabbit Target Name: GABRP Sample Tissue: Human HepG2 Whole Cell Antibody Dilution: 1ug/ml |
|
Image 2 | Human THP-1 Whole Cell
| Host: Rabbit Target Name: GABRP Sample Tissue: Human THP-1 Whole Cell Antibody Dilution: 1ug/ml |
|
Image 3 | Human Intestine
| Human Intestine |
|
Image 4 | Human 293T
| Host: Rabbit Target Name: GABRP Sample Tissue: Human 293T Antibody Dilution: 1.0ug/ml |
|
Image 5 | Human esophagus, Human stomach
| Host: Rabbit Target: GABRP Positive control (+): Human esophagus (ES) Negative control (-): Human stomach (ST) Antibody concentration: 1ug/ml |
|
Image 6 | Human HepG2 Whole Cell
| Host: Rabbit Target Name: GABRP Sample Tissue: Human HepG2 Whole Cell Antibody Dilution: 3ug/ml |
|
Image 7 | Human Jurkat Whole Cell
| Host: Rabbit Target Name: GABRP Sample Tissue: Human Jurkat Whole Cell Antibody Dilution: 3ug/ml |
|
Image 8 | Human Jurkat Whole Cell
| Host: Rabbit Target Name: GABRP Sample Tissue: Human Jurkat Whole Cell Antibody Dilution: 3ug/ml |
|