GABRD Antibody - N-terminal region (AVARP13032_P050)

• Product Number: AVARP13032_P050
• Name: GABRD Antibody - N-terminal region (AVARP13032_P050)
• Protein Size (# AA): 452 amino acids
• Molecular Weight: 51kDa
• Subunit: delta
• NCBI Gene Id: 2563
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Gamma-aminobutyric acid (GABA) A receptor, delta
• Alias Symbols: EJM7, EIG10, GEFSP5
• Peptide Sequence: Synthetic peptide located within the following region: MDAPARLLAPLLLLCAQQLRGTRAMNDIGDYVGSNLEISWLPNLDGLIAG
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Emberger,W., et al., (2000) Cytogenet. Cell Genet. 89 (3-4), 281-282
• Description of Target: Gamma-aminobutyric acid (GABA) is the major inhibitory neurotransmitter in the mammalian brain where it acts at GABA-A receptors, which are ligand-gated chloride channels. Chloride conductance of these channels can be modulated by agents such as benzodiazepines that bind to the GABA-A receptor. The GABA-A receptor is generally pentameric and there are five types of subunits: alpha, beta, gamma, delta, and rho. The GABRD gene encodes the delta subunit.Gamma-aminobutyric acid (GABA) is the major inhibitory neurotransmitter in the mammalian brain where it acts at GABA-A receptors, which are ligand-gated chloride channels. Chloride conductance of these channels can be modulated by agents such as benzodiazepines that bind to the GABA-A receptor. The GABA-A receptor is generally pentameric and there are five types of subunits: alpha, beta, gamma, delta, and rho. This gene encodes the delta subunit.
• Protein Interactions: NOTCH2NL; UBQLN1; UBQLN4; UBC;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-GABRD (AVARP13032_P050) antibody is Catalog # AAP30692 (Previous Catalog # AAPP01349)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GABRD
• Uniprot ID: O14764
• Protein Name: Gamma-aminobutyric acid receptor subunit delta
• Protein Accession #: NP_000806
• Purification: Affinity Purified
• Nucleotide Accession #: NM_000815
• Tested Species Reactivity: Human, Rat
• Gene Symbol: GABRD
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Rabbit
• Application: IHC, WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%
• Image 1: Human Fetal Kidney
  
  Host: Rabbit
  Target Name: GABRD
  Sample Tissue: Human Fetal Kidney
  Antibody Dilution: 1.0ug/ml
• Image 2: Rat brain section
  
  Sample Type:
  Rat brain section
  Primary Antibody Dilution:
  1:1000
  Secondary Antibody:
  Anti-rabbit-biotin, streptavidin-diaminobenzidine
  Secondary Antibody Dilution:
  1:500
  Gene Name:
  GABRD
  Submitted by:
  Dr. Amiel Rosenkranz, Rosalind Franklin University
• Image 3: Human Muscle
  
  Human Muscle
• Image 4: Human 786-0 Whole Cell
  
  Host: Rabbit
  Target Name: GABRD
  Sample Tissue: Human 786-0 Whole Cell
  Antibody Dilution: 1ug/ml