Product Number |
AVARP13026_T100 |
Product Page |
www.avivasysbio.com/gabra2-antibody-middle-region-avarp13026-t100.html |
Name |
GABRA2 Antibody - middle region (AVARP13026_T100) |
Protein Size (# AA) |
451 amino acids |
Molecular Weight |
51kDa |
Subunit |
alpha-2 |
NCBI Gene Id |
2555 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
Gamma-aminobutyric acid (GABA) A receptor, alpha 2 |
Alias Symbols |
DEE78, EIEE78 |
Peptide Sequence |
Synthetic peptide located within the following region: PMDAHSCPLKFGSYAYTTSEVTYIWTYNASDSVQVAPDGSRLNQYDLLGQ |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Tian,H., et al., Brain Res. Mol. Brain Res. 137 (1-2), 174-183 (2005) |
Description of Target |
GABA, the major inhibitory neurotransmitter in the vertebrate brain, mediates neuronal inhibition by binding to the gaba/benzodiazepine receptor and opening an integral chloride channel. |
Protein Interactions |
UBQLN1; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-GABRA2 (AVARP13026_T100) antibody |
Blocking Peptide |
For anti-GABRA2 (AVARP13026_T100) antibody is Catalog # AAP30684 (Previous Catalog # AAPP01341) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human GABRA2 |
Uniprot ID |
P47869 |
Protein Name |
Gamma-aminobutyric acid receptor subunit alpha-2 |
Publications |
Kitayama, T. et al. Phospholipase C-related but catalytically inactive protein modulates pain behavior in a neuropathic pain model in mice. Mol. Pain 9, 23 (2013). 23639135 |
Protein Accession # |
NP_000798 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_000807 |
Tested Species Reactivity |
Human |
Gene Symbol |
GABRA2 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Horse, Rabbit |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100% |
Image 1 | Human HepG2
| WB Suggested Anti-GABRA2 Antibody Titration: 1.25ug/ml ELISA Titer: 1:62500 Positive Control: HepG2 cell lysate |
|
Image 2 | Human Jurkat Whole Cell
| Host: Rabbit Target Name: GABRA2 Sample Tissue: Human Jurkat Whole Cell Antibody Dilution: 3ug/ml |
|