Product Number |
AVARP13024_T100 |
Product Page |
www.avivasysbio.com/chrng-antibody-n-terminal-region-avarp13024-t100.html |
Name |
CHRNG Antibody - N-terminal region (AVARP13024_T100) |
Protein Size (# AA) |
517 amino acids |
Molecular Weight |
57kDa |
NCBI Gene Id |
1146 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
cholinergic receptor nicotinic gamma subunit |
Alias Symbols |
ACHRG |
Peptide Sequence |
Synthetic peptide located within the following region: QEERLLADLMQNYDPNLRPAERDSDVVNVSLKLTLTNLISLNEREEALTT |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Arredondo,J., et al., (2005) Am. J. Pathol. 166 (2), 597-613 |
Description of Target |
The mammalian muscle-type acetylcholine receptor is a transmembrane pentameric glycoprotein with two alpha subunits, one beta, one delta, and one epsilon (in adult skeletal muscle) or gamma (in fetal and denervated muscle) subunit. This gene, which encodes the gamma subunit, is expressed prior to the thirty-third week of gestation in humans. The gamma subunit of the acetylcholine receptor plays a role in neuromuscular organogenesis and ligand binding and disruption of gamma subunit expression prevents the correct localization of the receptor in cell membranes. Mutations in this gene cause Escobar syndrome and a lethal form of multiple pterygium syndrome. Muscle-type acetylcholine receptor is the major antigen in the autoimmune disease myasthenia gravis.[ |
Protein Interactions |
Ubqln1; CHRNB4; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-CHRNG (AVARP13024_T100) antibody |
Blocking Peptide |
For anti-CHRNG (AVARP13024_T100) antibody is Catalog # AAP30670 |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human CHRNG |
Uniprot ID |
Q86U77 |
Protein Name |
Acetylcholine receptor subunit gamma |
Protein Accession # |
NP_000734 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_000743 |
Tested Species Reactivity |
Human |
Gene Symbol |
CHRNG |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Rabbit |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 92%; Dog: 100%; Guinea Pig: 92%; Human: 100%; Mouse: 85%; Rabbit: 100%; Rat: 85% |
Image 1 | Human MCF-7
| WB Suggested Anti-CHRNG Antibody Titration: 1.0ug/ml ELISA Titer: 1:312500 Positive Control: MCF7 cell lysate |
|
|