Product Number |
AVARP13022_T100 |
Product Page |
www.avivasysbio.com/chrnd-antibody-n-terminal-region-avarp13022-t100.html |
Name |
CHRND Antibody - N-terminal region (AVARP13022_T100) |
Protein Size (# AA) |
517 amino acids |
Molecular Weight |
59kDa |
Subunit |
delta |
NCBI Gene Id |
1144 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
Cholinergic receptor, nicotinic, delta (muscle) |
Alias Symbols |
ACHRD, CMS2A, CMS3A, CMS3B, CMS3C, FCCMS, SCCMS |
Peptide Sequence |
Synthetic peptide located within the following region: LTLGLLAALAVCGSWGLNEEERLIRHLFQEKGYNKELRPVAHKEESVDVA |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Gomez,C.M., et al., (2002) Ann. Neurol. 51 (1), 102-112 |
Description of Target |
The acetylcholine receptor of muscle has 5 subunits of 4 different types: 2 alpha and 1 each of beta, gamma and delta subunits. After acetylcholine binding, the receptor undergoes an extensive conformation change that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane. |
Protein Interactions |
GRB2; CHRNA1; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-CHRND (AVARP13022_T100) antibody |
Blocking Peptide |
For anti-CHRND (AVARP13022_T100) antibody is Catalog # AAP30679 |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human CHRND |
Uniprot ID |
Q07001 |
Protein Name |
Acetylcholine receptor subunit delta |
Protein Accession # |
NP_000742 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_000751 |
Tested Species Reactivity |
Human |
Gene Symbol |
CHRND |
Predicted Species Reactivity |
Human, Rat, Cow, Dog, Guinea Pig, Pig, Rabbit, Zebrafish |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 91%; Dog: 100%; Guinea Pig: 93%; Human: 100%; Pig: 100%; Rabbit: 86%; Rat: 85%; Zebrafish: 78% |
Image 1 | Human HepG2
| WB Suggested Anti-CHRND Antibody Titration: 2.5 ug/ml Positive Control: HepG2 Whole Cell |
|