| Product Number |
AVARP13022_P050 |
| Product Page |
www.avivasysbio.com/chrnd-antibody-n-terminal-region-avarp13022-p050.html |
| Name |
CHRND Antibody - N-terminal region (AVARP13022_P050) |
| Protein Size (# AA) |
517 amino acids |
| Molecular Weight |
59kDa |
| Subunit |
delta |
| NCBI Gene Id |
1144 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Cholinergic receptor, nicotinic, delta (muscle) |
| Alias Symbols |
ACHRD, CMS2A, CMS3A, CMS3B, CMS3C, FCCMS, SCCMS |
| Peptide Sequence |
Synthetic peptide located within the following region: LTLGLLAALAVCGSWGLNEEERLIRHLFQEKGYNKELRPVAHKEESVDVA |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Engel,A.G., et al., (1996) Hum. Mol. Genet. 5 (9), 1217-1227 |
| Description of Target |
The acetylcholine receptor of muscle has 5 subunits of 4 different types: 2 alpha and 1 each of beta, gamma and delta subunits. After acetylcholine binding, the receptor undergoes an extensive conformation change that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane. |
| Protein Interactions |
GRB2; CHRNA1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-CHRND (AVARP13022_P050) antibody |
| Blocking Peptide |
For anti-CHRND (AVARP13022_P050) antibody is Catalog # AAP30679 (Previous Catalog # AAPP01336) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human CHRND |
| Uniprot ID |
Q07001 |
| Protein Name |
Acetylcholine receptor subunit delta |
| Protein Accession # |
NP_000742 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_000751 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
CHRND |
| Predicted Species Reactivity |
Human, Rat, Cow, Dog, Guinea Pig, Pig, Rabbit, Zebrafish |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 91%; Dog: 100%; Guinea Pig: 93%; Human: 100%; Pig: 100%; Rabbit: 86%; Rat: 85%; Zebrafish: 78% |
| Image 1 | Human HepG2
 | WB Suggested Anti-CHRND Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2 cell lysate |
| | Image 2 | Human kidney
 | Human kidney |
|
|
