| Product Number |
AVARP13021_P050 |
| Product Page |
www.avivasysbio.com/chrnb3-antibody-middle-region-avarp13021-p050.html |
| Name |
CHRNB3 Antibody - middle region (AVARP13021_P050) |
| Protein Size (# AA) |
458 amino acids |
| Molecular Weight |
53kDa |
| Subunit |
beta-3 |
| NCBI Gene Id |
1142 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Cholinergic receptor, nicotinic, beta 3 (neuronal) |
| Peptide Sequence |
Synthetic peptide located within the following region: YDGTMVDLILINENVDRKDFFDNGEWEILNAKGMKGNRRDGVYSYPFITY |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Boorman,J.P., et al., (2003) J. Biol. Chem. 278 (45), 44033-44040 |
| Description of Target |
Nicotinic acetylcholine receptors (nAChRs) are ligand-gated ion channels nAChRs are pentameric structures that are made up of combinations of individual subunits. CHRNB3 is one of the subunits of nAChR. Twelve neuronal nAChR subunits have been described, alpha2-alpha10 and beta2-beta4. CHRNB3 decreased the channel mean open time and burst length. There was also an increase in single channel slope conductance. On the other hand, the calcium permeability and the pharmacological properties of beta3-containing receptors differed little from those of without beta3. Dysfunction of nAChR has been linked to a number of human diseases such as schizophrenia, Alzheimer's and Parkinson's diseases. nAChRs also play a significant role in nicotine addiction. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-CHRNB3 (AVARP13021_P050) antibody |
| Blocking Peptide |
For anti-CHRNB3 (AVARP13021_P050) antibody is Catalog # AAP30678 (Previous Catalog # AAPP01335) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human CHRNB3 |
| Uniprot ID |
Q05901 |
| Protein Name |
Neuronal acetylcholine receptor subunit beta-3 |
| Protein Accession # |
NP_000740 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_000749 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
CHRNB3 |
| Predicted Species Reactivity |
Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 93%; Mouse: 100%; Rabbit: 100%; Rat: 100% |
| Image 1 | Human Jurkat
 | WB Suggested Anti-CHRNB3 Antibody Titration: 0.03ug/ml
ELISA Titer: 1:1562500
Positive Control: Jurkat cell lysate |
|
|
