Product Number |
AVARP13019_P050 |
Product Page |
www.avivasysbio.com/chrna9-antibody-n-terminal-region-avarp13019-p050.html |
Name |
CHRNA9 Antibody - N-terminal region (AVARP13019_P050) |
Protein Size (# AA) |
479 amino acids |
Molecular Weight |
55 kDa |
Subunit |
alpha-9 |
NCBI Gene Id |
55584 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Cholinergic receptor, nicotinic, alpha 9 (neuronal) |
Alias Symbols |
NACHRA9, HSA243342 |
Peptide Sequence |
Synthetic peptide located within the following region: MNWSHSCISFCWIYFAASRLRAAETADGKYAQKLFNDLFEDYSNALRPVE |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Peng,H., et al., (2004) Life Sci. 76 (3), 263-280 |
Description of Target |
CHRNA9 is a member of the ligand-gated ionic channel family and nicotinic acetylcholine receptor superfamily. CHRNA9 is a plasma membrane protein that forms homo- or hetero-oligomeric divalent cation channels. It is involved in cochlea hair cell development and is also expressed in the outer hair cells (OHCs) of the adult cochlea.This gene is a member of the ligand-gated ionic channel family and nicotinic acetylcholine receptor gene superfamily. It encodes a plasma membrane protein that forms homo- or hetero-oligomeric divalent cation channels. This protein is involved in cochlea hair cell development and is also expressed in the outer hair cells (OHCs) of the adult cochlea. The protein is additionally expressed in keratinocytes, the pituitary gland, B-cells and T-cells. |
Protein Interactions |
UBC; Rapsn; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Enhanced Validation |
Relative Expression (Western Blot) |
|
|
Datasheets/Manuals |
Printable datasheet for anti-CHRNA9 (AVARP13019_P050) antibody |
Blocking Peptide |
For anti-CHRNA9 (AVARP13019_P050) antibody is Catalog # AAP30675 (Previous Catalog # AAPP01332) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human CHRNA9 |
Uniprot ID |
Q9UGM1 |
Protein Name |
Neuronal acetylcholine receptor subunit alpha-9 |
Publications |
Guha, P. et al. Nicotine promotes apoptosis resistance of breast cancer cells and enrichment of side population cells with cancer stem cell-like properties via a signaling cascade involving galectin-3, a9 nicotinic acetylcholine receptor and STAT3. Breast Cancer Res. Treat. 145, 5-22 (2014). 24668500 |
Protein Accession # |
NP_060051 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_017581 |
Tested Species Reactivity |
Human |
Gene Symbol |
CHRNA9 |
Predicted Species Reactivity |
Mouse, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Mouse: 93%; Rabbit: 100%; Zebrafish: 80% |
Image 1 | Human Jurkat
| WB Suggested Anti-CHRNA9 Antibody Titration: 0.0625ug/ml ELISA Titer: 1:312500 Positive Control: Jurkat cell lysate |
|
Image 2 | Western Blot
| 25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment. |
|