CHRNA9 Antibody - N-terminal region (AVARP13019_P050)

Data Sheet
 
Product Number AVARP13019_P050
Product Page www.avivasysbio.com/chrna9-antibody-n-terminal-region-avarp13019-p050.html
Name CHRNA9 Antibody - N-terminal region (AVARP13019_P050)
Protein Size (# AA) 479 amino acids
Molecular Weight 55 kDa
Subunit alpha-9
NCBI Gene Id 55584
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Cholinergic receptor, nicotinic, alpha 9 (neuronal)
Alias Symbols NACHRA9, HSA243342
Peptide Sequence Synthetic peptide located within the following region: MNWSHSCISFCWIYFAASRLRAAETADGKYAQKLFNDLFEDYSNALRPVE
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Peng,H., et al., (2004) Life Sci. 76 (3), 263-280
Description of Target CHRNA9 is a member of the ligand-gated ionic channel family and nicotinic acetylcholine receptor superfamily. CHRNA9 is a plasma membrane protein that forms homo- or hetero-oligomeric divalent cation channels. It is involved in cochlea hair cell development and is also expressed in the outer hair cells (OHCs) of the adult cochlea.This gene is a member of the ligand-gated ionic channel family and nicotinic acetylcholine receptor gene superfamily. It encodes a plasma membrane protein that forms homo- or hetero-oligomeric divalent cation channels. This protein is involved in cochlea hair cell development and is also expressed in the outer hair cells (OHCs) of the adult cochlea. The protein is additionally expressed in keratinocytes, the pituitary gland, B-cells and T-cells.
Protein Interactions UBC; Rapsn;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Enhanced Validation
Relative Expression (Western Blot) Avivasheild
Datasheets/Manuals Printable datasheet for anti-CHRNA9 (AVARP13019_P050) antibody
Blocking Peptide For anti-CHRNA9 (AVARP13019_P050) antibody is Catalog # AAP30675 (Previous Catalog # AAPP01332)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human CHRNA9
Uniprot ID Q9UGM1
Protein Name Neuronal acetylcholine receptor subunit alpha-9
Publications

Guha, P. et al. Nicotine promotes apoptosis resistance of breast cancer cells and enrichment of side population cells with cancer stem cell-like properties via a signaling cascade involving galectin-3, a9 nicotinic acetylcholine receptor and STAT3. Breast Cancer Res. Treat. 145, 5-22 (2014). 24668500

Protein Accession # NP_060051
Purification Affinity Purified
Nucleotide Accession # NM_017581
Tested Species Reactivity Human
Gene Symbol CHRNA9
Predicted Species Reactivity Mouse, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Mouse: 93%; Rabbit: 100%; Zebrafish: 80%
Image 1
Human Jurkat
WB Suggested Anti-CHRNA9 Antibody Titration: 0.0625ug/ml
ELISA Titer: 1:312500
Positive Control: Jurkat cell lysate
Image 2
Western Blot
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment.
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com