CHRNA7 Antibody - N-terminal region (AVARP13018_T100)

• Product Number: AVARP13018_T100
• Name: CHRNA7 Antibody - N-terminal region (AVARP13018_T100)
• Protein Size (# AA): 502 amino acids
• Molecular Weight: 56 kDa
• Subunit: alpha-7
• NCBI Gene Id: 1139
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Gene Full Name: Cholinergic receptor, nicotinic, alpha 7 (neuronal)
• Alias Symbols: NACHRA7, CHRNA7-2
• Peptide Sequence: Synthetic peptide located within the following region: QGEFQRKLYKELVKNYNPLERPVANDSQPLTVYFSLSLLQIMDVDEKNQV
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Avramopoulou,V., et al., (2004) J. Biol. Chem. 279 (37), 38287-38293
• Description of Target: The nicotinic acetylcholine receptors (nAChRs) are members of a superfamily of ligand-gated ion channels that mediate fast signal transmission at synapses. The nAChRs are thought to be hetero-pentamers composed of homologous subunits. The proposed structure for each subunit is a conserved N-terminal extracellular domain followed by three conserved transmembrane domains, a variable cytoplasmic loop, a fourth conserved transmembrane domain, and a short C-terminal extracellular region. The protein encoded by this gene forms a homo-oligomeric channel, displays marked permeability to calcium ions and is a major component of brain nicotinic receptors that are blocked by, and highly sensitive to, alpha-bungarotoxin. Once this receptor binds acetylcholine, it undergoes an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane. CHRNA7 is located in a region identified as a major susceptibility locus for juvenile myoclonic epilepsy and a chromosomal location involved in the genetic transmission of schizophrenia. An evolutionarily recent partial duplication event in this region results in a hybrid containing sequence from CHRNA7 and a novel FAM7A gene.
• Protein Interactions: ATXN1; ADCY6; PIK3R1; APP; FYN;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Enhanced Validation: Relative Expression (Western Blot)
  
• Blocking Peptide: For anti-CHRNA7 (AVARP13018_T100) antibody is Catalog # AAP30674 (Previous Catalog # AAPP01331)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CHRNA7
• Uniprot ID: P36544
• Protein Name: Neuronal acetylcholine receptor subunit alpha-7
• Protein Accession #: NP_000737
• Purification: Protein A purified
• Nucleotide Accession #: NM_000746
• Tested Species Reactivity: Human, Rat
• Gene Symbol: CHRNA7
• Predicted Species Reactivity: Human, Mouse, Rat, Cow
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Human: 100%; Mouse: 100%; Rat: 100%
• Image 1: Human Jurkat Whole Cell
  
  Host: Rabbit
  Target Name: CHRNA7
  Sample Tissue: Human Jurkat Whole Cell
  Antibody Dilution: 1ug/ml
• Image 2: Rat Brain
  
  Host: Rat
  Target Name: CHRNA7
  Sample Tissue: Rat Brain
  Antibody Dilution: 1ug/ml
• Image 3: Western Blot
  
  25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment.